KEGG   Pseudoalteromonas phenolica: PP2015_2524Help
Entry
PP2015_2524       CDS       T04165                                 

Definition
(GenBank) Putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
pphe  Pseudoalteromonas phenolica
Pathway
pphe00790  Folate biosynthesis
pphe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pphe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PP2015_2524
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pphe04147]
    PP2015_2524
Enzymes [BR:pphe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     PP2015_2524
Exosome [BR:pphe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PP2015_2524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ALO43014
UniProt: A0A0S2K402
Position
I:complement(2898532..2898876)
Genome map
AA seq 114 aa AA seqDB search
MSDLSAQKCEACRADAPKVSDEELAVLIKQIPDWVPEVRDGIMQLERVFKFKNFKQALEF
TNKVGDMAEEEGHHPGLLTEWGKVTITWWSHSIKGLHKNDFVCAAKTDEVFNAL
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttaagtgcacaaaaatgtgaagcgtgtcgtgcggatgcgcctaaagtgtca
gatgaagagttagcagtattaattaagcagatccctgattgggttccagaagtgcgtgat
ggcatcatgcaacttgagcgtgtattcaagttcaaaaacttcaagcaggcattagagttc
actaacaaagtgggcgatatggctgaagaagaaggtcaccacccaggtcttctaacagag
tggggcaaggtgacaatcacttggtggagccactctattaaaggcctgcataagaacgat
tttgtatgcgcagcgaaaacagacgaagttttcaacgctctataa

DBGET integrated database retrieval system