KEGG   Pseudoalteromonas phenolica: PP2015_3398Help
Entry
PP2015_3398       CDS       T04165                                 

Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pphe  Pseudoalteromonas phenolica
Pathway
pphe00620  Pyruvate metabolism
pphe00630  Glyoxylate and dicarboxylate metabolism
pphe01100  Metabolic pathways
pphe01110  Biosynthesis of secondary metabolites
pphe01120  Microbial metabolism in diverse environments
pphe01200  Carbon metabolism
Module
pphe_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pphe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PP2015_3398
   00630 Glyoxylate and dicarboxylate metabolism
    PP2015_3398
Enzymes [BR:pphe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PP2015_3398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ALO43873
UniProt: A0A0S2K6H0
Position
II:13193..15388
Genome map
AA seq 731 aa AA seqDB search
MLRKIFMSATVQQAGLTIDQQLYDFVNQQALPGTGLQAEAFWQGFADLVNELTPINKSLL
SKRDTLQLQIDAFHKQQRQWDAQVYKSFLTEIGYLVPEPEEATITTEHVEPEIALTAAPQ
LVVPVSNARFALNAANARWGSLYDALYGTDLLPEKDGAEKQKAYNPVRGFKVMAYARQFL
DIALPLQSGSHIESTNYSVLDEQLVVTLNDSSQVSLSTPAQFVGYQGQAQNPSALLFKHH
DLHIEIQIDPHNPIGQADKAGIKDVLLEAALTTIMDCEDSVAAVDAEDKVGVYRNWLGLM
NGTLTDTFVKDGQELTRSLATDREYTSKSGERLSLKGRSMMFVRNVGHLMTNPAILDQNG
EEIFEGIMDAVITSLCAMHDLQGNSPFKNSTAASVNIVKPKMHGPEEVVFTNTLFSRVES
LLCLPENTLKMGIMDEERRTSVNLMACINQAKSRVVFINTGFLDRTGDEIHTSMVAGPVL
PKAQIKAQPWIAAYEDQNVDIGLKCGFSGKAQIGKGMWPMPDKMAMMMEQKLAHPKSGAN
TAWVPSPTAATLHAMHYHQVDVFAIQAELKARQQASLDDLLTPPLLLDVELSKEDIQSEL
ENNAQGILGYVVRWIDQGVGCSKVPDINHIGLMEDRATLRISSQHIANWLKHGICTPEQV
QATFAKMAEVVDTQNQHDTYYTPMALSNDSLTNNLAYQAALALVFEGEQQPNGYTEPLLH
SYRLKYKAANN
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcttaggaagatattcatgagtgcaactgttcaacaagctggcttaaccatagatcag
caactttatgacttcgttaatcaacaggctttgccgggcaccggtttgcaggcagaggct
ttttggcaaggttttgctgatctggtcaatgaactaacaccaatcaataaatcattactt
tcaaagcgcgatacgctgcagttacagattgatgcttttcacaagcagcaaagacaatgg
gatgctcaggtttataaatcatttttgactgaaattggttatctagtgcctgagcctgaa
gaagcaacgattaccaccgaacacgttgaacctgagattgcgctcacagcagccccacag
ctggttgtgcctgtaagcaatgcacgttttgcattaaatgcggcgaatgcaaggtggggc
tcgctctatgatgcgttgtacggcactgatttattgccagaaaaagacggagctgaaaaa
caaaaagcatataacccggtacgtggctttaaagtaatggcttacgcgaggcagttttta
gatattgccctgcccctgcaatcaggctctcacattgagagtactaattactcagtgcta
gacgaacaacttgttgtcactttgaatgacagctcgcaagtctcgctttcgacacctgca
cagtttgtgggttatcaagggcaagcacagaatccatctgctttattgttcaagcaccat
gatttacacattgaaattcaaattgacccgcataatcctatcggacaagctgataaagcg
gggatcaaagacgtattactcgaagccgcattaacgacaattatggactgtgaagactct
gtggccgctgttgacgctgaagataaagttggcgtttatcgtaattggttgggcttaatg
aacgggactctgaccgatacttttgttaaagatggtcaagaactgacgcgaagcttagca
accgatcgtgaatataccagtaagagtggtgagcgtttgagcttgaaaggtcgcagcatg
atgtttgtgcgcaatgtcgggcatttaatgacgaaccctgcgatcttagatcaaaatggc
gaggagatatttgaagggatcatggatgcggtgatcacgtcgctttgcgctatgcatgat
ctgcaaggtaatagcccatttaaaaactcaacggcggcgagcgttaatatcgttaaacca
aaaatgcatggtccagaagaagtcgtttttaccaatacccttttctctcgtgttgaaagt
ttactctgtttgccagaaaatactctaaaaatgggcattatggacgaagagcgccgcact
tctgtgaatttaatggcctgtattaaccaagctaaatcacgagtggtatttattaatacc
gggttcttagacagaaccggtgatgaaatccacacctcaatggtcgcgggtccagtattg
cctaaagctcagatcaaggcacaaccttggatagcggcttatgaagatcagaatgtcgat
attggtctaaagtgcggtttcagtggcaaggcgcagatcggtaaaggcatgtggccgatg
ccagataaaatggcaatgatgatggaacaaaagttggctcatcctaaatcgggtgccaat
actgcttgggtgccttctccaacagctgcaactctgcatgcgatgcattaccatcaagta
gatgtttttgctattcaggccgaattgaaagcgcgtcaacaagcgtcacttgatgactta
ttaacgccacctttgttgcttgatgtagagctgagcaaagaagatattcaatctgaactt
gagaataatgcacagggcattctgggctatgttgtacgctggatagatcaaggcgttggt
tgctccaaagtaccagatatcaatcatataggattaatggaagaccgagcgactttacgt
atttcaagccagcatatcgctaattggttgaaacatggcatttgtacacctgagcaagta
caggcaacgtttgccaaaatggcagaagtggtcgatacgcaaaatcagcacgacacatac
tacacgcccatggcattaagtaatgatagcctaacgaacaatctagcgtatcaagcggca
ttagccttggttttcgaaggtgagcaacagcctaatggctacacagagccgcttttacat
agttatcgccttaaatacaaagctgcaaataactaa

DBGET integrated database retrieval system