KEGG   Pseudoalteromonas phenolica: PP2015_3486Help
Entry
PP2015_3486       CDS       T04165                                 

Definition
(GenBank) Oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
pphe  Pseudoalteromonas phenolica
Pathway
pphe00620  Pyruvate metabolism
pphe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pphe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PP2015_3486
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pphe02000]
    PP2015_3486
Enzymes [BR:pphe01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     PP2015_3486
Transporters [BR:pphe02000]
 Other transporters
  Primary active transporters [TC:3]
   PP2015_3486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: ALO43961
UniProt: A0A0S2K6X1
Position
II:117418..119199
Genome map
AA seq 593 aa AA seqDB search
MSKLKLTELVLRDAHQSLLATRMRLEDMLPIAEKLDKAGYWSVESWGGATFDSCIRYLGE
DPWYRIRALKEAMPNTKQQMLLRGQNLLGYRHYADDVVEKFIERAHHNGVDVFRIFDAMN
DVRNLETAIKAAIKVGAHAQGTISYTVSPVHTLDMWLDQAKKLEAMGCHSICIKDMAGLL
KPYDAEELITELKNTVSVPIAMQCHATTGLSTATYQKAIDAGIDMLDTAISSMSMTYGHS
ATETMVAITEGTARDTGLNLGELEEIASYFREVRKKYAAFEGSLKGVDGRILLAQVPGGM
LTNMENQLKEQGAGDKLDDVLKEIPAVRKDLGFIPLVTPTSQIVGTQAVLNVLTGERYKT
ITKETAGVLKGEYGSTPAEVDSELQQRVLDGAEAITCRPADLIDAELDSLEAELVAKAKE
DNIELADDQVDDVLTYALFPQIGLKFLKNRNNPDAFEPKPTLVTTEKPTPAAKPASPQKQ
STERYSVQVDGKVYDVVVAPGGELKEVQVKDSELIPQSASVSTSETLNAPLAGNIFKLLV
RAGDAVAEGDVVMIMEAMKMETEVRATHSGTVANVLVSEGDSVATGDAMIELA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagttaaaattaactgaattggttttaagagacgcacaccaatcgttgcttgct
acgcgaatgcgcctagaagatatgctgccgatcgcagagaaattagataaagcagggtat
tggtctgttgagtcttggggtggtgcaacttttgattcttgtattcgttatctaggcgaa
gatccttggtaccgtattcgcgctttaaaagaagctatgccaaataccaaacagcaaatg
cttttgcgtggtcagaacttactgggttatcgtcattatgccgatgatgtggtagagaaa
tttattgagcgtgcacatcataatggtgtagatgttttccgtattttcgatgccatgaat
gatgttagaaaccttgaaacagcaattaaagcggcgataaaagtcggtgcacatgcacag
ggcaccatttcttacactgtcagtccggttcacactttagatatgtggctagatcaggcg
aaaaagcttgaagccatgggttgtcactcgatttgtattaaagatatggcgggtttatta
aagccatatgatgcagaagagctgatcactgagcttaaaaatactgtatcggtaccaatc
gccatgcagtgtcatgcgacaacaggcttaagcactgccacataccaaaaagccatcgat
gcaggtattgatatgcttgataccgctatttcgtctatgagtatgacttatggccatagc
gccacagagaccatggtggcgatcacagagggtacagcgcgtgatacaggtttaaatctt
ggcgagctagaagaaattgcgagttatttccgcgaagtacgaaagaaatatgcggcattt
gaaggtagtttaaagggcgttgatggccgtatcctactcgctcaagtgcctggtggcatg
ttaactaatatggaaaaccagcttaaagaacaaggcgcgggcgataagctagatgatgtt
ttaaaagagatcccagctgttcgtaaagaccttggttttattccgcttgtgacaccaaca
tcacaaatcgtcggtactcaggcggtactaaatgttctaactggtgagcgttacaagacc
atcactaaagaaacggcgggtgtgttaaaaggtgagtatggttcaactcctgctgaagtt
gactcagagttacaacaacgcgtattagatggagctgaagcgatcacgtgtcgccctgct
gatttaatcgatgcagaacttgatagccttgaagctgagctagttgctaaagctaaagaa
gacaatattgagctggctgatgatcaagttgatgacgtgttaacttatgcgttattcccg
caaatcggtcttaaattccttaagaatcgcaataacccagatgcgtttgagccgaaacca
actctagttaccactgaaaagcctacgcctgcagcaaaaccggcttctccacaaaaacaa
tcaacagagcgttacagcgtgcaagttgatggcaaagtatatgacgttgttgtggcacca
ggtggtgaacttaaagaagtgcaagtgaaagacagtgaacttattccacagtcagcatcg
gtcagtacgagcgaaacactgaatgcaccgcttgccggtaacatttttaagttattggtg
cgtgcaggagatgcagtcgctgaaggcgatgtagtcatgatcatggaagccatgaagatg
gaaacagaagtgcgtgcaacgcacagcggtacggttgcaaatgtcttagtctctgaaggt
gactctgtcgcaacgggcgatgccatgattgagcttgcatag

DBGET integrated database retrieval system