KEGG   Pseudoalteromonas phenolica: PP2015_982Help
Entry
PP2015_982        CDS       T04165                                 

Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
pphe  Pseudoalteromonas phenolica
Brite
KEGG Orthology (KO) [BR:pphe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PP2015_982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ALO41500
UniProt: A0A0S2JZN5
Position
I:complement(1121707..1122096)
Genome map
AA seq 129 aa AA seqDB search
MTTSSNLGSPIKVSVETMYVEHQSQPEKDKYVFAYTITIKNHSLCNAKLESRYWLITDAN
GKETEVEGEGVVGERPTIAPGETYSYTSGAVLDTPVGTMQGHYVMRNEFGTEFQAPIDVF
RLARPNILH
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaagcagtaacttaggatcgcctataaaggtatctgtagaaaccatgtacgtt
gagcaccaatctcaaccggaaaaagataagtatgttttcgcttacactattactataaaa
aatcatagtttatgtaatgcaaaactagaaagtcgctactggctcattactgacgcaaat
ggcaaagaaacagaagttgaaggtgaaggtgtcgttggtgaacgcccgacaatcgcccca
ggtgaaacatattcttacaccagcggtgcagttttagatacaccggttggtaccatgcag
ggtcactatgttatgagaaatgagtttggtactgagttccaagctccgatcgatgtattt
agattagcacgtccgaatattctccattaa

DBGET integrated database retrieval system