KEGG   Pannonibacter phragmitetus: APZ00_00385Help
Entry
APZ00_00385       CDS       T04214                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
pphr  Pannonibacter phragmitetus
Brite
KEGG Orthology (KO) [BR:pphr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    APZ00_00385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ALV25722
UniProt: A0A0L0J5W8
Position
complement(89976..90368)
Genome map
AA seq 130 aa AA seqDB search
MYRAVTNGIQVTVEPFYLADQSSPEEGSYVWGYTVEIVNLGDVPVQLRRRHWLITDGNGQ
MQEVEGPGVVGEEPVIKPGEAFEYSSGCPLTTPSGIMEGAYLMELPDGRMMNVSIPPFSL
DTPNRRGFLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgggccgttaccaacgggatacaggtcacagtcgaacccttctatctggcggac
cagtcctcgccggaagaggggagctatgtctggggctataccgtcgagatcgtcaatctc
ggggatgtgccggtccagttgcgccgccgccactggctgattacggacggcaacggccag
atgcaggaagtggaagggccgggtgtggtcggggaagagccggtcatcaagccgggcgaa
gcctttgaatattcctccggctgcccgctgaccacgccctccggcatcatggaaggtgcc
tatctgatggagctgccggacgggcgcatgatgaatgtctccatcccgcccttctcgctg
gacactccgaaccggcgcgggtttctgaactga

DBGET integrated database retrieval system