KEGG   Pannonibacter phragmitetus: APZ00_07165Help
Entry
APZ00_07165       CDS       T04214                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00071  Fatty acid degradation
pphr00072  Synthesis and degradation of ketone bodies
pphr00280  Valine, leucine and isoleucine degradation
pphr00310  Lysine degradation
pphr00362  Benzoate degradation
pphr00380  Tryptophan metabolism
pphr00620  Pyruvate metabolism
pphr00630  Glyoxylate and dicarboxylate metabolism
pphr00640  Propanoate metabolism
pphr00650  Butanoate metabolism
pphr00900  Terpenoid backbone biosynthesis
pphr01100  Metabolic pathways
pphr01110  Biosynthesis of secondary metabolites
pphr01120  Microbial metabolism in diverse environments
pphr01130  Biosynthesis of antibiotics
pphr01200  Carbon metabolism
pphr01212  Fatty acid metabolism
pphr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pphr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    APZ00_07165
   00630 Glyoxylate and dicarboxylate metabolism
    APZ00_07165
   00640 Propanoate metabolism
    APZ00_07165
   00650 Butanoate metabolism
    APZ00_07165
  Lipid metabolism
   00071 Fatty acid degradation
    APZ00_07165
   00072 Synthesis and degradation of ketone bodies
    APZ00_07165
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APZ00_07165
   00310 Lysine degradation
    APZ00_07165
   00380 Tryptophan metabolism
    APZ00_07165
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    APZ00_07165
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    APZ00_07165
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    APZ00_07165
Enzymes [BR:pphr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     APZ00_07165
Exosome [BR:pphr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APZ00_07165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALV26890
UniProt: A0A0U2W2U2
Position
1528772..1529938
Genome map
AA seq 388 aa AA seqDB search
MTGTTAHDPVIVAARRSPVAPRGAAFARLDLAQLGAPVLQAALTDAGLPVEAVDEVILGN
ALGAGGNPARLVALAAGLPHTVSAMTVDRQCCSGLDAVILAARAIRAGEADVVIAGGVES
FSRAPVRMHRPLQKGAVPVAYDRPAFAPPPFPDPDPAEAAARLALHMQISREAQEAYARA
SHAAALRAQAAGDLATETVPLAGLAADAFTRPLDARLQSRLPVLAGGNTYGLTASTIAVE
ADAAAILVMMSRKEAEHRGLMPLAAVGQGVMTGGDPANPAAGAHEAALELFRRTGMGLED
ISFVELMEAFAVQAMAGRRAIGLGPDDLRVNQGGGALARGHPIGASGAILAVRLAHILAR
GPRKGIGLAAIAAAGGLGTALFLQSTRG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcacaacggcgcatgaccccgtgattgtggccgcccggcgctcgcccgtggcc
ccgcgcggcgccgcctttgcgcggctggacctggcgcaactgggcgcgcccgtgctgcag
gcagccctcactgatgccgggctgcccgtggaggcggtggatgaggtgatccttggcaat
gcgctcggcgcgggcggcaatcctgcccggctggtggccctggccgcggggctgccgcac
accgtcagcgccatgaccgtcgaccggcaatgctgctccggccttgatgcggtgatcctc
gcggcccgcgccatccgggccggggaggcggatgtggtcattgcgggcggcgttgaaagt
ttctcccgcgcgccggtccgcatgcaccgcccgctgcagaagggcgccgtgcctgttgcc
tatgaccgcccggcctttgcgccaccgccgtttccggatccggacccggcagaggccgca
gccaggctggcgctgcatatgcaaatcagccgtgaggcacaggaagcctatgcccgtgcc
agccatgcggccgccttgcgggctcaggcggccggagaccttgcaacagagaccgttccg
ctggctgggcttgccgccgatgccttcacacgtccgcttgatgcaaggctgcagtcccgg
cttcccgtgcttgcgggtgggaacacctatgggctgacagcatcgaccatcgccgtggaa
gccgatgcagctgcgatccttgtgatgatgagccgcaaggaagctgagcaccggggtttg
atgcctctggccgcagtggggcagggcgttatgaccggcggcgatccggccaatccggct
gcgggggcgcatgaggcggcgctggaactcttccgccgcaccggcatgggccttgaagac
atctcttttgtggagctgatggaggccttcgccgttcaggcaatggcgggccgcagggcg
atcggccttggccctgatgatctgcgcgtcaatcaggggggcggggcgctcgcacgtggc
catcccattggcgcatccggcgccatcctggcggtccggctcgcccatatcctcgccagg
gggccgcgcaaaggcataggactggctgcgattgccgccgccggagggctcggaacggcg
ttgtttctgcagtccacacggggttga

DBGET integrated database retrieval system