KEGG   Pannonibacter phragmitetus: APZ00_07390Help
Entry
APZ00_07390       CDS       T04214                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00071  Fatty acid degradation
pphr00072  Synthesis and degradation of ketone bodies
pphr00280  Valine, leucine and isoleucine degradation
pphr00310  Lysine degradation
pphr00362  Benzoate degradation
pphr00380  Tryptophan metabolism
pphr00620  Pyruvate metabolism
pphr00630  Glyoxylate and dicarboxylate metabolism
pphr00640  Propanoate metabolism
pphr00650  Butanoate metabolism
pphr00900  Terpenoid backbone biosynthesis
pphr01100  Metabolic pathways
pphr01110  Biosynthesis of secondary metabolites
pphr01120  Microbial metabolism in diverse environments
pphr01130  Biosynthesis of antibiotics
pphr01200  Carbon metabolism
pphr01212  Fatty acid metabolism
pphr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pphr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APZ00_07390
   00630 Glyoxylate and dicarboxylate metabolism
    APZ00_07390
   00640 Propanoate metabolism
    APZ00_07390
   00650 Butanoate metabolism
    APZ00_07390
  09103 Lipid metabolism
   00071 Fatty acid degradation
    APZ00_07390
   00072 Synthesis and degradation of ketone bodies
    APZ00_07390
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APZ00_07390
   00310 Lysine degradation
    APZ00_07390
   00380 Tryptophan metabolism
    APZ00_07390
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    APZ00_07390
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    APZ00_07390
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    APZ00_07390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pphr04147]
    APZ00_07390
Enzymes [BR:pphr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     APZ00_07390
Exosome [BR:pphr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APZ00_07390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C B12-binding ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALV26924
UniProt: A0A0U3PH23
Position
1583934..1585115
Genome map
AA seq 393 aa AA seqDB search
MSASTDVVIVSATRTAVGSFNGSFANTPAHELGATVIKAALAKAGVDVADVNELIFGQVL
TAGQGQNPARQAAIAAGLSQDSTAWLLNQVCGSGLRTVAIAAQQIMCGDASIVIAGGQEN
MSLSPHCAPMRAGYKMGDYKMIDTMIKDGLWDAFNGYHMGQTAENVAQKWQISRDEQDAF
ALASQNKAEAAQKAGRFKDEITPVTIADRKGDKVIEDDEYIRHGATLESMSKLRPAFNKE
GSVTAGNASGINDGAAALVVMSAAEAARRGLTPLARIASWATAGVDPAVMGSGPIPASRK
ALEKAGWSVADLDLVEANEAFAAQACAVNKDMGWNPDIVNVNGGAIAIGHPIGASGARVL
VTLLHEMGRRDAKKGLATLCIGGGMGVALCVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcttctacagacgtcgttattgtcagtgccacccgcacggccgtgggttcattc
aacgggtctttcgccaatacaccggcccatgagctgggtgccaccgtcatcaaggcagcg
ctggcaaaggcaggcgtggatgtcgccgacgtcaacgaactgatcttcggccaggtgctc
accgccggtcaggggcagaacccggcccgtcaggccgccattgccgccggcctctcccag
gattccaccgcgtggctgctcaaccaggtctgcggctccggcctgcgtacggtggccatt
gctgcccagcagatcatgtgcggcgacgccagcatcgtgattgcaggcggccaggaaaac
atgtcgctctcgccgcactgcgcaccgatgcgcgccggctacaagatgggcgactacaag
atgatcgacaccatgatcaaggacggcctgtgggatgccttcaacggctaccacatgggc
cagacggcggaaaacgtcgcccagaagtggcagatcagccgtgacgagcaggacgccttc
gcccttgcctcgcagaacaaggcggaagctgcccagaaggccggccgcttcaaggacgag
atcacgcccgtcaccatcgccgaccgcaagggcgacaaggtgatcgaggatgacgaatac
atccgccatggcgcaacgctggaaagcatgtccaagctgcgcccggccttcaacaaggaa
ggctccgtcaccgcaggcaatgcctcgggcatcaatgacggcgctgcggcgctggtggtg
atgagcgcggccgaagctgcccgccgcggcctcaccccgctcgcccgcattgcgtcgtgg
gcaacggcaggcgttgatccggccgtcatgggctccggcccgatcccggcctcgcgcaag
gcgctggagaaagccggctggagcgttgccgacctcgatctggtggaagccaacgaagcc
ttcgcggcgcaggcctgtgccgtcaacaaggacatgggctggaacccggacatcgtcaat
gtcaacggcggtgccatcgccatcggtcatccgattggtgcatcgggtgcgcgcgttctc
gtcacgctgctgcacgaaatgggccgccgtgacgccaagaagggccttgcgacgctctgc
atcggcggcggcatgggcgtggcgctctgcgtcgagcgctaa

DBGET integrated database retrieval system