KEGG   Pannonibacter phragmitetus: APZ00_09110Help
Entry
APZ00_09110       CDS       T04214                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00061  Fatty acid biosynthesis
pphr00071  Fatty acid degradation
pphr01100  Metabolic pathways
pphr01212  Fatty acid metabolism
pphr02024  Quorum sensing
Module
pphr_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pphr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    APZ00_09110
   00071 Fatty acid degradation
    APZ00_09110
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    APZ00_09110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pphr01004]
    APZ00_09110
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pphr04147]
    APZ00_09110
Enzymes [BR:pphr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     APZ00_09110
Lipid biosynthesis proteins [BR:pphr01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   APZ00_09110
Exosome [BR:pphr04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   APZ00_09110
  Exosomal proteins of breast cancer cells
   APZ00_09110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding YwhD
Motif
Other DBs
NCBI-ProteinID: ALV27200
UniProt: A0A0U3NC67
Position
1965039..1967024
Genome map
AA seq 661 aa AA seqDB search
MARLTSAAREGADTFPKILLCNAKELGSRTAVREKDLGIWQSWTWAEVLDETRSFSIGLG
SIGLKAGDKVAIVGANRPRLYWSMVAAQALGAIPVPVYADSVAEEMAYVLGHAEVRFAVV
EDQEQVDKLLSMAETVPSLSAVIYDDPRGLRDYDHSRLFSFTGVQDLGRQHMAADPKALS
AWEEGLAQGKGSDIAVMLYTSGTTGRPKGVMLSFDNLVISARNANAFDKLDESEDILAYL
PLAWIGDHVFSLAQAYTAGYCVNCPESLDTVDLDRLEIAPTYFFAPPRVFESMLTRIMVR
MEDAGRMKKAMFDYFMGVARRSGEKILNGQPVPLSDRLLYGLGELLVYGPLKNRIGLTRL
KVGYTAGEAIGPEIFSFYRSLGLNLKQLYGQTEASVYITLQPDGEIFADTVGKPAPQVEL
KIAENGEVLYRSPGTFVAYYKNDEATRTTKTEDGWVFTGDAGFIAPNGHLKIIDRAKDVG
KLNTGALFAPKYIENKLKFFPNIKEAVAFGNERDFVGVFLNIDLTAVGSWAERNNVNYAS
YQELAAHPDVYRMIQQHVDQVNRDLAAEPMMAGAQIHRFLILHKELDADDGELTRTQKVR
RSFIAERYAPLIEGLYDGSTSRHVRTEVTFEDGRTGVIEATVEIRDMTPHAPVQAMREAA
E
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggcaagattgaccagcgctgcgagggaaggtgcggacacctttccgaagattctcttg
tgcaatgcgaaagaacttggaagccgtactgcagtgcgggagaaggaccttggtatctgg
caaagctggacctgggctgaagttcttgacgaaacgcgcagcttttcgatcgggcttggc
agtatcggcttgaaggcaggcgacaaggtcgcaattgtcggtgccaacaggccccggctt
tactggtcgatggtggcggctcaggcgctcggcgccatcccggttccggtctatgctgac
tccgtcgcggaagaaatggcctatgttctgggtcatgccgaagttcgctttgcagttgtg
gaggatcaggagcaggtcgacaagcttctctccatggcggagaccgtgccgagcctgagt
gccgtgatctatgatgatccgcgcggcctgcgggactatgaccacagccgcctgttcagc
ttcaccggcgtgcaggatcttggccgccagcacatggcagcagacccgaaggcgctcagc
gcctgggaagaggggctggcacagggcaagggcagcgacatcgccgtgatgctctacact
tccggcaccaccggccgccctaaaggcgtgatgctgtccttcgacaatctggtcatttcg
gcgcgcaacgccaatgccttcgacaagctggacgagagcgaggacatcctcgcctatctg
ccgctggcctggatcggcgaccacgtgttctcgctggcacaggcctatacggccggttac
tgcgtcaactgcccggaaagcctcgacacggtggatctggaccggctggagatcgcgccg
acctatttcttcgctcccccgcgcgttttcgaaagcatgctcacccgcatcatggtgcgc
atggaagatgcaggccggatgaagaaggccatgttcgactatttcatgggagtggcccgc
cggtcgggcgaaaagatcctcaacggccagccggtgccgctcagcgaccggctgctctac
ggccttggcgagcttctggtctatggcccgctgaagaatcgcattggcctgacccggctg
aaggtcggctacacggcgggtgaagccatcggcccggagatcttcagcttctaccgctcg
ctcggcctcaatctgaagcagctctacggccagacggaagccagcgtctacatcaccctg
cagccggatggcgagatctttgccgatacggtcggcaagcccgcgccgcaggtggagttg
aagatcgcggaaaatggcgaagtgctctaccgctcgccgggcaccttcgtcgcctattac
aagaacgacgaggccacccgcaccaccaagacggaagatggctgggtctttaccggtgac
gccggcttcattgcccccaacggccacctgaagatcatcgaccgcgccaaggatgtgggc
aagctcaatacaggcgcgctgttcgcgccgaaatacatcgagaacaagctgaagttcttc
cccaacatcaaggaggcggtggctttcggcaatgagcgggatttcgttggcgtattcctc
aacatcgacctgacggcggtgggcagctgggcggagcgcaacaatgtcaattacgccagc
tatcaggaacttgccgcccatccggacgtctaccggatgatccagcagcatgtggatcag
gtgaaccgggatctggcggcggagccgatgatggcgggtgcgcagatccaccgcttcctc
atcctgcacaaggagctggatgcggatgacggcgagctgacgcgcacgcagaaagtccgc
cggtccttcatcgccgagcgctacgcgccgctgatcgaagggctttatgacggctccacc
tcgcgccatgtgcgcaccgaagtgaccttcgaggacggccgcacgggcgttatcgaggcc
acggtcgagatcagggacatgacgccgcacgccccggtgcaggccatgcgggaggctgca
gaatga

DBGET integrated database retrieval system