KEGG   Pannonibacter phragmitetus: APZ00_15205Help
Entry
APZ00_15205       CDS       T04214                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00020  Citrate cycle (TCA cycle)
pphr00480  Glutathione metabolism
pphr01100  Metabolic pathways
pphr01110  Biosynthesis of secondary metabolites
pphr01120  Microbial metabolism in diverse environments
pphr01130  Biosynthesis of antibiotics
pphr01200  Carbon metabolism
pphr01210  2-Oxocarboxylic acid metabolism
pphr01230  Biosynthesis of amino acids
Module
pphr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pphr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pphr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APZ00_15205
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    APZ00_15205
Enzymes [BR:pphr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     APZ00_15205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ALV28245
UniProt: A0A0U3P952
Position
complement(3324268..3326499)
Genome map
AA seq 743 aa AA seqDB search
MADTGRPDIIYTKVDEAPELASASFLPIIKAFAKPAGISIGTRDISLAGRILAAFPQYLT
DAQKQSDDLAELGRLVIEPDANVIKLPNISASQPQLNAAIKELQAQGYAIPSYPDNPATD
EDKAVKAAYDAIKGSAVNPVLREGNSDRRAPNAVKEYAKKNPHSMGAWLPTSKTHVATMG
KDDFAANEKSVTVAAASAGTARIEFVAKDGAVTVLKNNLKLTEGDVLDATFMSAKALTAF
LEKEIQDAKDKGVLFSVHLKATMMKVSDPIIFGHVVKTFLKDLFAKHAATFAEIGVNPDL
GIGDLEAKIATLPADKAAEIKADLKAALDNGPAMYMVNSDKGITNLHVSSDVIIDASMPA
LIRAGGKGWGPDGKENDAKCVIPDSSYAGVYDAVIEFCKKNGALDPSKMGTVPNVGLMAQ
KAEEYGSHPQTFKAQADGSIRIVDAAGTTLLEHAVEGGDIWRACLTKDAPIRDWVKLGVS
RARLSGMPGVFWLDKNRAHDAELIKKVEAYLPEHDTSGLDLQIMSPSDAARYSTERIAKG
LDTISITGNVLRDYLTDLYPILEVGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQLVE
ENYLRWDSLGEFCALGASLEHLAQVKSNAKAQVLADALDKAIEKLLDNDKSPQRKVGQLD
NRGSHFYIALYWAQGLAAQDKDAELKAYFAPVAEALTANEAKIVAELNSVQGKAADLGGY
YHAPADKVAAVMRPSATLNAIIG
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaccggacgtcccgacatcatctacaccaaggtcgacgaagcgcctgaactg
gcgagcgcgtccttcctgccgatcatcaaggcttttgccaaaccggccgggatctccatc
ggcaccagggacatttcgctggcaggccgcatcctcgccgccttcccgcagtatctgacg
gacgcacagaagcagtccgacgatctggccgagcttggccgtctggtgatcgagccggat
gcaaacgtcatcaagctgccgaacatctccgcctcgcagccgcagctcaatgccgcaatc
aaggaactgcaggcacagggctatgccatcccctcctacccggacaatccggcaacggac
gaggacaaggccgtcaaggctgcctatgacgcgatcaagggttcggccgtgaacccggtt
ctgcgtgaaggcaattccgaccgccgcgccccgaatgcggtgaaggaatacgccaagaag
aacccgcactcgatgggcgcctggctgcccacctccaagacccatgtcgccaccatgggc
aaggatgactttgccgccaacgaaaagtccgtgacggttgccgccgcttccgccggcact
gcgcgcatcgagttcgtggccaaggatggtgccgtcaccgttctgaagaacaacctgaag
ctcaccgaaggcgatgtgctggacgccaccttcatgagcgccaaggccctgaccgccttc
cttgagaaggaaatacaggacgccaaggacaagggcgtgctcttctccgtgcacctcaag
gccacgatgatgaaggtctccgacccgatcatcttcggccatgtggtcaagaccttcctg
aaggacctcttcgccaagcacgccgccaccttcgctgagatcggcgtcaaccctgacctc
ggcatcggcgatctggaagccaagattgccaccctgcccgctgacaaggccgctgaaatc
aaggctgacctcaaggctgcgctcgacaatggcccggccatgtacatggtgaactccgac
aagggcatcaccaacctgcatgtctcgtccgacgtcatcatcgacgcctccatgcctgcc
ctcatccgcgccggcggcaagggctggggcccggatggcaaggaaaatgatgccaagtgc
gtgatcccggactcgtcctatgccggcgtctatgacgcggtgatcgagttctgcaagaag
aacggcgctcttgacccgtccaagatgggcaccgtgccgaacgtcggcctgatggcccag
aaggccgaggaatacggctcgcatccgcagaccttcaaggcgcaggccgatggctccatc
cgcatcgtcgatgcggccggcaccacgctgctggagcatgcggttgaaggcggcgacatc
tggcgcgcctgcctcaccaaggacgccccgatccgtgactgggtgaagctcggcgtcagc
cgcgcccgcctctccggcatgccgggcgtgttctggctggacaagaaccgcgcccatgat
gccgagctgatcaagaaggtggaagcctatctgccggagcatgacacgtcgggcctcgac
ctgcagatcatgtcgccgagcgatgccgcccgctactcgacggagcggattgccaagggc
ctcgacaccatctccatcaccggcaacgtgctgcgcgactacctgacggacctctatccg
atcctggaagtcggcacctcggccaagatgctgtccatcgtgccgctgatgaacggcggc
ggcctgtttgaaacgggcgccggcggctctgcccccaagcacgtgcagcagctggtggaa
gaaaactacctgcgctgggattcgctcggcgaattctgcgccctcggcgcctcgctggag
catctggcccaggtcaagtccaacgccaaggcccaggttctggcggacgcactggacaag
gccatcgagaagctgctggacaacgacaagtccccgcagcgcaaggtcggccagctcgac
aaccgcggcagccacttctacatcgcgctctactgggcacagggccttgccgcacaggac
aaggacgcggagctgaaggcgtatttcgccccggtcgccgaagccctgacggccaatgag
gcgaagatcgtggcggaactcaacagtgtgcagggcaaggctgccgacctcggcggctac
taccacgccccggcggacaaggttgccgccgtcatgcgcccgagcgccacgctgaacgcc
atcatcggctga

DBGET integrated database retrieval system