KEGG   Pannonibacter phragmitetus: APZ00_18340Help
Entry
APZ00_18340       CDS       T04214                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00450  Selenocompound metabolism
pphr00970  Aminoacyl-tRNA biosynthesis
pphr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pphr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    APZ00_18340
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    APZ00_18340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pphr01007]
    APZ00_18340
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pphr03016]
    APZ00_18340
Enzymes [BR:pphr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     APZ00_18340
Amino acid related enzymes [BR:pphr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   APZ00_18340
Transfer RNA biogenesis [BR:pphr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    APZ00_18340
 Prokaryotic type
   Other AARSs
    APZ00_18340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ALV28771
UniProt: A0A0U3PIT3
Position
complement(4010022..4011578)
Genome map
AA seq 518 aa AA seqDB search
MTDKPRYYITTAISYPNGVPHIGHAYEAIATDAMARFQRLDGKDVFFLTGTDEHGQKMLQ
TARKEGITAQELADRNSARFRAMVEALGCTNNDFIRTSEERHHKASQEIWKRMAANGDIY
KDSYSGWYSVRDEAFYQEGETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLAHY
EANPDFIGPSERRNEIVSFVSRGLKDLSVSRTTFDWGIPVPGDERHVMYVWVDALTNYIT
GAGFPDEGDARWSYWPADAHIIGKDIIRFHAVYWPAFLMSAGIPLPKRVYAHGFLFNRGE
KMSKSVGNVIDPFSLIEHYGLDQTRYFFLREVPFGQDGNYSHEAIVNRINADLANDLGNL
ASRSLSMISKNCDGKLPQPGALHPADEAILAQADAMLETCRAAFSKQEIHAGLACIWACV
AEANRYFASQEPWALKKTDPERMNTVLYVTAEVIRQIAILAQPVTPAAAAKLLDNLSVPA
GARSFATLGAAGRLAAGVEIPKPEPAFPRYVEPEQADA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagccccgctactacatcaccacggccatttcctaccccaacggtgtgccg
cacatcggccatgcctatgaggcgattgccacggatgcgatggcccgtttccagcggctg
gatggcaaggatgtgttcttcctgacgggcacggacgagcacggccagaagatgctgcag
acggcgcgcaaggaaggcatcaccgcgcaggaactggcggaccgcaattccgcccgtttc
cgcgccatggtcgaggctctcggctgcaccaacaacgacttcatccgcaccagcgaggag
cgccaccacaaggcgagccaggaaatctggaagcggatggcggcgaatggcgacatctac
aaggacagctattccggctggtactcggtgcgcgacgaggccttctatcaggagggcgag
accgaagtgcgagccgatggcgtgcgctacggcccgcagggcacgccggtggagtgggtg
gaggaggagagctacttcttccgcctgtccgcctatcaggacaagcttctggcccattac
gaggccaatccggacttcatcggcccgtccgagcgccgcaacgagatcgtcagcttcgtc
agccgcgggctgaaggacctgtccgtttcgcgcaccaccttcgactggggcattccggtg
ccgggcgacgagcggcatgtgatgtatgtgtgggtggatgcgctcaccaactacatcacc
ggcgcaggctttccggatgagggggatgcgcgctggtcctactggccggcggatgcccat
atcatcggcaaggacatcatccgattccacgcggtctactggcctgccttcctgatgtcg
gccggcatcccgctgcccaagcgcgtctatgcccacggcttcctgttcaaccgcggggag
aagatgtcgaagtcggtcggcaacgtcatcgaccccttcagcctgatcgagcattacggc
ctcgaccagacccgctacttcttcctgcgcgaggtgcctttcggacaggacggcaactac
agccacgaggcgatcgtcaaccgcatcaacgccgatctggccaatgaccttggcaatctg
gcgtcgcgctccctgtcgatgatctccaagaactgcgacggcaagctgccgcagccgggt
gcgcttcatccggccgacgaggccattctggcgcaggccgacgccatgctggagacctgc
cgcgcggccttctccaagcaggaaatccatgcgggtcttgcctgcatctgggcctgcgtg
gccgaagccaaccgctactttgcgtcgcaggagccctgggcactgaagaagaccgatccg
gagcgcatgaacacggtgctctatgtcacggccgaagtgatccgccagatcgccattctg
gcccagccggtgaccccggcggcggcggccaagctgctcgacaacctgtcggttccggcc
ggcgcccgcagctttgcaacgcttggcgcagccgggcggcttgccgccggcgtggaaatc
cccaagcccgagccggctttcccgcgctatgtggagccggaacaggcggacgcataa

DBGET integrated database retrieval system