KEGG   Pannonibacter phragmitetus: APZ00_23630Help
Entry
APZ00_23630       CDS       T04214                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00620  Pyruvate metabolism
pphr00630  Glyoxylate and dicarboxylate metabolism
pphr01100  Metabolic pathways
pphr01110  Biosynthesis of secondary metabolites
pphr01120  Microbial metabolism in diverse environments
pphr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pphr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APZ00_23630
   00630 Glyoxylate and dicarboxylate metabolism
    APZ00_23630
Enzymes [BR:pphr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     APZ00_23630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ALV30351
UniProt: A0A0L0J7K0
Position
complement(5183003..5185165)
Genome map
AA seq 720 aa AA seqDB search
MTERIEIDGLKIARALHDFVNDQALPGTGVSPQVFWSGFAKILADLAPVNRALLEKRDGL
QAAIDAWHRANPGAPDMEAYKAFLTELGYLVPEGADFAVGTQNVDPEIGEVAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAMGTPPAGGGYDEARGAQVIAYARKVLDEAAPLAE
GSWSQVTGLAVEGGALVCSLMSGKTGLAAPEQFAGYTGGAQDPEKVLLRRNGLHLEILRD
RTHRIGATDKAGIADVVVEAALSTIMDCEDSVAAVDAEDKVTVYANWLGLMKGDLEDTFE
KGGRQMTRRLNGDRTYLSPRGDTFTLHGRSLMLVRNVGHLMTIDAVLDAEGNEVPEGILD
GMVTAAIALHDIGPKGRCANSRAGSVYIVKPKMHGPEEVAFADTLFARIEDVLGMARNTL
KMGIMDEERRTTVNLKECIRAAKDRVFFINTGFLDRTGDEMHTSMEAGPMIRKGDMKAAA
WISAYEANNVDVGLACGLPGHAQIGKGMWAMPDLMKAMIEQKIGHPMAGANTAWVPSPTA
AALHALHYHKVSVAARQEELKSRPKAKLEDILSIPVATRPNWSAEDIQAELDNNAQGILG
YVVRWVDQGIGCSKVPDIHNVGLMEDRATLRISSQHIANWLRHGVCSREQVMETMKRMAA
VVDRQNTGDPAYQPMAADFDGSVAFQAACDLVFKGVEQPNGYTEPVLHARRREAKARQRG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacggattgaaatcgatggcctgaagattgcgcgcgcgcttcatgacttcgtg
aatgatcaggccctgccgggcactggcgtcagtccgcaggtgttctggagcggctttgcg
aagatcctggcggatctggcgccggtgaaccgggccctccttgaaaagcgcgacgggctg
caggccgccattgatgcctggcaccgggccaatccgggcgcgccggacatggaggcctac
aaggctttcctgacggagctcggctatctggtgccggaaggcgcggattttgcggttggc
acgcagaatgtggacccggaaatcggcgaagtcgccgggccgcagctcgtggtgccggtg
atgaatgcgcgctatgcgctgaatgcggcaaatgcccgctggggctcgctctacgacgcg
ctttacggcaccgacgccatgggcacgccaccggcaggcggtggctatgacgaagcgcgc
ggggcgcaggtgattgcctatgcccgcaaggtgctggatgaggcggcgcctctggccgaa
ggctcctggtcgcaggtgaccgggcttgccgttgaaggcggagcgctggtctgttcgctc
atgtccggcaagaccgggcttgccgcgccggagcagttcgccggttatacgggcggggct
caggatccggagaaggtgctgctgcgccgcaacggcctgcatctggaaatcctgcgggac
cgcacccaccggatcggcgccacggacaaggcgggcatcgccgatgtcgtggtggaggcg
gcgctgtccaccatcatggactgcgaggattccgttgccgctgtggatgcggaagacaag
gtgacggtctatgccaactggctgggcctgatgaagggcgatctggaagacacgttcgag
aagggcgggcgtcagatgacccgccgcctcaacggcgaccggacctatctgtcgccgcga
ggagacaccttcacgctgcatggccgctcgctgatgctggtgcgcaatgtcgggcacctg
atgactatcgatgcggtgctggatgcggagggcaacgaggtgccggaaggcattctcgac
ggcatggtgacggcggccatcgcgctgcatgacatcgggccgaagggccggtgcgccaac
agccgggcgggctcggtctatatcgtcaagccgaagatgcacgggccggaagaggtggcc
tttgccgatacgctgtttgcgcgcatcgaggacgtgctgggcatggcccgcaacacgctg
aagatgggcatcatggacgaggagcgccgcaccacggtgaacctgaaggagtgcatccgc
gctgcgaaggacagggtgttcttcatcaacaccggtttcctcgaccgtacgggcgacgag
atgcacacctcgatggaggccgggccgatgatccgcaagggcgacatgaaggccgccgca
tggatctcggcctatgaagccaacaatgtggatgtgggtcttgcctgcgggctgccgggc
catgcgcagatcggcaagggcatgtgggccatgccggacctgatgaaggcgatgatcgag
cagaagatcggccacccgatggctggggccaacaccgcctgggtgccgtcgcctaccgct
gccgcactgcatgcgctgcattaccacaaggtcagcgtcgccgcccgccaggaagagctg
aagagccgcccgaaggcaaagctggaggacattctctccatcccggtggccacacggccg
aactggagcgcggaagacatccaggccgaactcgacaacaatgcccagggcatccttggc
tatgtggtgcgctgggtggatcagggcatcggctgctccaaggtcccggatattcacaac
gtggggctgatggaggaccgggcgacgctgcgcatttcctcgcagcatatcgccaactgg
ctgcgccatggcgtctgctcacgcgaacaggtgatggaaaccatgaagcgcatggctgct
gtggtggaccggcagaacaccggtgatccggcctatcagccgatggccgcagatttcgac
ggctccgtcgcgttccaggcggcctgtgatctggtgttcaagggcgttgagcagcccaat
ggctacaccgagccggtgctgcacgcccgccgccgcgaggccaaggcccgccagcgcggc
tga

DBGET integrated database retrieval system