KEGG   Pseudomonas putida ND6: ND055
Entry
ND055             CDS       T02170                                 

Gene name
nahAc
Definition
(GenBank) naphthalene dioxygenase Fe-S protein large subunit
  KO
K14579  naphthalene 1,2-dioxygenase subunit alpha [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00624  Polycyclic aromatic hydrocarbon degradation
ppi00626  Naphthalene degradation
ppi00627  Aminobenzoate degradation
ppi00633  Nitrotoluene degradation
ppi00642  Ethylbenzene degradation
ppi01100  Metabolic pathways
ppi01120  Microbial metabolism in diverse environments
ppi01220  Degradation of aromatic compounds
Module
ppi_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ND055 (nahAc)
   00633 Nitrotoluene degradation
    ND055 (nahAc)
   00642 Ethylbenzene degradation
    ND055 (nahAc)
   00626 Naphthalene degradation
    ND055 (nahAc)
   00624 Polycyclic aromatic hydrocarbon degradation
    ND055 (nahAc)
Enzymes [BR:ppi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     ND055 (nahAc)
    1.14.12.23  nitroarene dioxygenase
     ND055 (nahAc)
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     ND055 (nahAc)
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: AAP44288
UniProt: Q6XUJ7
Structure
PDB: 

Position
pND6-1:55857..57206
AA seq 449 aa
MSYNNKILVSESGLSQKHLIHGDEELFQHELKTIFARNWLFLTHDSLIPAPGDYVTAKMG
IDEVIVSRQNDGSIRAFLNVCRHRGKTLVSVEAGNAKGFVCSYHGWGFGSNGELQSVPFE
KDLYGESLNKKCLGLKEVARVESFHGFIYGCFDQEAPPLMDYLGDAAWYLEPMFKHSGGL
ELVGPPGKVVIKANWKAPAENFVGDAYHVGWTHASSLRSGESIFSSLAGNAALPPEGAGL
QMTSKYGSGIGVLWDVYSGVHSADLVPELMAFGGAKQERLNKEIGDVRARIYRSHLNCTV
FPNNSMLTCSGVFKVWNPIDANTTEVWTYAIVEKDMPEDLKRRLADSVQRTFGPAGFWES
DDNDNMETASQNGKKYQSRDSDLLSNLGFGEDVYGDAVYPGVVGKSAIGETSYRGFYRAY
QAHVSSSNWAEFEHASSTWHTELTKTTDR
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgagttacaataataaaatcttggtaagtgaatctggtctgagccaaaagcacctgatt
catggcgatgaagaacttttccaacatgaactgaaaaccatttttgcgcggaactggctt
tttctcactcatgatagcctgattcctgcccccggcgactatgttaccgcaaaaatgggg
attgacgaggtcatcgtctcccggcagaacgacggttcgattcgtgcttttctgaacgtt
tgccggcatcgtggcaagacgctggtgagcgtggaagccggcaatgccaaaggttttgtt
tgcagctatcacggctggggcttcggctccaacggtgaactgcagagcgttccatttgaa
aaagatctgtacggcgagtcgctcaataaaaaatgtctggggttgaaagaagtcgctcgc
gtggagagcttccatggcttcatctacggttgcttcgaccaggaggcccctcctcttatg
gactatctgggtgacgctgcttggtacctggaacctatgttcaagcattccggcggttta
gaactggtcggtcctccaggcaaggttgtgatcaaggccaactggaaggcacccgcggaa
aactttgtgggagatgcataccacgtgggttggacgcacgcgtcttcgcttcgctcgggg
gagtctatcttctcgtcgctcgctggcaatgcggcgctaccacctgaaggcgcaggcttg
caaatgacctccaaatacggcagcggcattggtgtgttgtgggacgtatattcaggtgtg
catagcgcagacttggttccggaattgatggcattcggaggcgcaaagcaggaaaggctg
aacaaagaaattggcgatgttcgcgctcggatttatcgcagccacctcaactgcaccgtt
ttcccgaacaacagcatgctgacctgctcgggtgttttcaaagtatggaacccgatcgac
gcaaacaccaccgaggtctggacctacgccattgtcgaaaaagacatgcctgaggatctc
aagcgccgcttggccgactctgttcagcgaacgttcgggcctgctggcttctgggaaagc
gacgacaatgacaatatggaaacagcttcgcaaaacggcaagaaatatcaatcaagagat
agtgatctgctttcaaaccttggtttcggtgaggacgtatacggcgacgcggtctatcca
ggcgtcgtcggcaaatcggcgatcggcgagaccagttatcgtggtttctaccgggcttac
caggcacacgtcagcagctccaactgggctgagttcgagcatgcctctagtacttggcat
actgaacttacgaagactactgatcgctaa

DBGET integrated database retrieval system