KEGG   Pseudomonas putida ND6: YSA_00322
Entry
YSA_00322         CDS       T02170                                 

Definition
(GenBank) ImcF domain-containing protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi02025  Biofilm formation - Pseudomonas aeruginosa
ppi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YSA_00322
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    YSA_00322
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppi02044]
    YSA_00322
Secretion system [BR:ppi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YSA_00322
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C
Other DBs
NCBI-ProteinID: AFK66949
UniProt: I3UN78
Position
complement(169767..173387)
AA seq 1206 aa
MNQIWTQLKRWGWPWVTRIGLALPLLLGLGALLMLVAIWWLGPQWTWREQQPLASVAHRS
VASLVLVLVPLLCWLGVLRTRFRRLQAERRQALAAEQDVALPFVQAQERALSQGLERYLD
NAGGRRALYRLPWYLVLGDEQAGKSSFIDRTDQRFTLTRIDQAQARGRQAEALAYPVGWW
VSDDAVIIDPPGVFISQKPPVGSAANDPTNASSPPGIQARLWEHLLGWLQRKRSQRALNG
VLLVVDLPALLHGKPEQRVALAHGLRTRLYEVSSQLGARLPLYVVLTKFDLLDGFDQFYS
QLPAAKRESLLGFTFKLDAVDAFDAWLDEYDEHYGRLLTQLHEQVIDRLDVLGKTAPCVR
LFSLHAQLIGLRPILQAFLRETLASDRFTTPPLVRGVYWSSVVQQGDMRNAFVREAAQPY
TTKLPLREGKAQGKALVYFIQQAFRRVIYQEAGLAGDNVRVARSKRHLLWVGSGVGILAF
SIAIASWQRYAEINGAKAASVLAKSQEYSGHEVDMRLDPTGRNLLAPLDQIRDAVAVFGD
YRAAWPVVADFGLYQGRNIGPLVDEAYLSLLSKRFLPALASGVIDAMNAAPPGSEQQMAA
LRVYRMIEDRNSRRPEWVEGWMARQWQRAFPGQGQLQRDLMQHLKYALAYADTDLPQYRQ
RVSEVQQVLRKLPLPQRVYAGLKQQSYEQVHAGLDLRHQVGPAFDVVYQPSSGSRQGGED
VRLAGMLTAKGFRDYFEPHSQRFAEMAMVDQWALGERSQLDYSDVDRDALTERLYNLYSA
DYIDSWRRALNAFTVADFRDLDHGVAILEQLTGPAAPLQRLLDTVRDNTSLASPAVVESP
GELSTLRVATGKPEQPQALAIQRAFAGLGAMLQATGEKPSYYDETLGAVAAVLDYAKAVQ
DSPDRGKAALQAVHQRFAMTGQDPIGTLQRVATGLPEPISHQVRKLADQTAQVLNVEALR
ELERRWDADVYSFFQQRLAGRYPFVVKAPDASLDDFEAFFGPKGRLQQFNDRYLKVFLKD
NLEALQSAQHGQSLIRADVIEQLELAERIRETFFDQRGKLSVQFSIEPLGLSANQRTSLL
DLDGQLIAYTHGPSHITGIVWPNTLGQQVRSNLTLLRQNGNSSSLEYRGPWSMFRLLSRG
ALNGRTATSVDLSFRTGDGVMRYRLNAEKAFNPITQQPFKGFRLPRGLLQQPANGVQAAL
SDEQRL
NT seq 3621 nt   +upstreamnt  +downstreamnt
atgaatcaaatatggacgcaactcaaacgttggggctggccgtgggtaacgcgcattggc
ctggcgctgccgctgctgctcgggcttggcgctttgctgatgctggtcgctatctggtgg
cttggcccgcaatggacgtggcgggagcagcagccgctggcaagtgtggctcatcgcagc
gtggcaagcctggtgctcgtgctggtgccgcttctgtgctggcttggggtgctgcgcacg
cgctttcgccgcctgcaagcggagcgccggcaggcactggccgccgaacaggatgtcgcg
ctaccgttcgtgcaggcgcaagagcgggccttgagccaggggcttgagcggtatctcgac
aatgccggtgggcgacgcgcgttgtaccggctgccttggtacctggtgttgggcgacgaa
caggccggtaaaagcagcttcatcgaccgcaccgatcagcgctttaccctgacgcgtatc
gaccaggcccaggcacggggccgacaggctgaagcactggcctatccggtaggctggtgg
gtcagcgacgatgccgtgatcatcgacccgcccggcgttttcatcagtcaaaaaccaccg
gtgggctcggcggccaacgaccccaccaatgcctcctcgccgcccggtatccaggcccgg
ttatgggagcacctgttgggctggctgcagcgtaagcgaagccagcgggcgctcaatggt
gtgttgctggtggtcgacctgccggcgctgctgcatggcaagcccgagcagcgcgtcgcg
ctggcccatgggttgcgcacacgcctgtacgaagtgagcagtcagttgggcgcgcgcctg
ccgctgtacgtggttctgaccaaattcgatctgctggacggcttcgaccagttctacagc
cagcttccggccgccaagcgtgaaagcctgttggggttcaccttcaagctggatgcggtt
gacgcgttcgacgcctggctggatgagtatgacgagcactacgggcggcttctcacccaa
ttgcatgagcaggtcatcgatcggctggatgtactgggcaagacagcaccgtgcgtgcgc
ctgttctcactgcatgcacagctgatcgggttgcgccccatactgcaggcattcttgcgc
gaaaccctggcgagtgaccggttcaccacgccacccttggtgcgtggtgtgtactggtcg
tcagtggtacagcaaggcgacatgcgcaatgcctttgtccgtgaagcggctcagccctac
acgacgaagctacccctgcgtgaaggtaaggcacaggggaaggcgttggtctatttcatc
cagcaagcattcaggcgggttatttatcaggaagccgggctggcgggcgacaatgttcgg
gttgcgcgcagcaagcgccacttgctgtgggtgggctctggtgtaggcatcctggcgttc
agtatcgccattgccagctggcagcgttacgccgagatcaatggcgccaaggctgccagt
gtgctcgccaaaagccaggagtacagtggtcacgaagtcgatatgcgtcttgatccgacc
gggcgcaacctgctggcgccactggaccagattcgcgatgcggtggcggtgtttggcgac
tatcgtgcggcctggccggtggttgccgattttggcttgtatcaagggcgcaacattggt
cccttggttgatgaggcgtacctcagcttgttgtcgaaacgtttcttgccggccttggcc
agtggtgtgatcgatgccatgaacgctgcaccacctggcagtgagcaacaaatggccgcg
ctcagggtttaccggatgatcgaggaccgcaacagccgccggccagaatgggtcgagggc
tggatggcccgtcagtggcaacgggcctttcctggccagggtcagttgcagcgtgacctc
atgcagcacctgaagtacgccttggcctatgccgataccgatttgccgcaataccgccag
cgggtcagcgaagtgcagcaggtgttgcgcaaattgccgttgccacagcgggtctacgca
gggctgaaacaacaatcgtacgagcaggtgcacgccgggctggacctgcgccaccaggta
gggcctgcgttcgatgtggtgtaccagccgtcttccgggtcaaggcaagggggggaggat
gtaaggctggccggcatgctcaccgccaaaggcttcagggattacttcgagccgcacagc
caacgcttcgctgaaatggcgatggttgatcaatgggcattgggggagcgcagtcaactc
gactattcggacgtcgaccgcgatgcgttgaccgagcggctgtataacctctacagcgcc
gattacattgacagctggcggcgcgccctgaacgcgtttacggtggctgacttccgtgat
ctggaccatggtgtcgcgatcctggagcagttgaccggccccgcagcaccgttgcaacgg
ctgctggatacggtcagggataacacctcgcttgcgtctccagcagttgttgaatcaccg
ggtgagctgagtacgctgcgggtagcaaccggaaaacccgagcaaccgcaagcgttggcc
atccagcgggcgtttgcaggcctgggcgccatgctgcaggcgacaggagaaaagccgagc
tactacgatgaaacccttggcgctgttgcggccgtgctggactacgccaaggccgtacag
gacagcccggaccgcggcaaggccgcgttgcaagccgtgcatcagcgctttgcgatgaca
gggcaggacccgatcggtaccctgcaacgtgttgccacaggtttaccggagcctatcagc
caccaggtcagaaagctcgccgaccagactgcccaggtgctgaacgttgaagcactgcgc
gaactggagcgacgttgggatgctgacgtgtacagttttttccagcaacgcctggcaggc
cgctacccctttgtggtgaaggcacccgatgcttctttggatgacttcgaggcgttcttc
gggccgaaagggcgcctgcagcagtttaatgatcggtatctcaaggttttcctgaaggac
aaccttgaagctttgcagtccgctcagcacgggcaatccctgattcgtgccgacgtgatc
gagcagctcgagctggcggagcgcatccgcgaaaccttcttcgatcagcgtggcaagctg
agtgtgcagttcagcatcgagcccttggggctcagtgcgaaccagcgtaccagcctgctg
gacctggatggccagttgattgcctacacccatggcccaagccatatcacgggtattgtc
tggcccaataccctggggcagcaggtccgtagcaatctcaccttgctaaggcaaaatggc
aacagcagcagcctggagtaccgtggcccgtggtcgatgttccgcttgctcagccgcggc
gcgctcaatggccggacggcgaccagcgtggacctgagcttccggaccggagatggcgtg
atgcgctatcggcttaacgctgaaaaagccttcaatcctattacccagcaaccgttcaaa
ggcttccgcttgccccgaggcttattgcaacagccagccaatggggtgcaggcggcgcta
tcggatgagcagcgactatga

DBGET integrated database retrieval system