KEGG   Pseudomonas putida ND6: YSA_00340Help
Entry
YSA_00340         CDS       T02170                                 

Definition
(GenBank) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YSA_00340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppi02044]
    YSA_00340
Secretion system [BR:ppi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YSA_00340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: AFK66959
UniProt: I3UN88
Position
181543..182340
Genome map
AA seq 265 aa AA seqDB search
MKPHPLLLATLLLALVVPTGCTSLSRMSQVAMDHSLPIGPPKDHPTEVAFSINASPTLNG
NPNSLDVAAEQDSALEPSPYAVTLSAGDPYALTEKIGVLFEYLQAQFPAMSPVELDEGDE
SDPARSPLEESGPGSYDDPQVALTLPRTTSVASALVATPIAITILQLRDDSLLRNTVYQL
LEQDPAKALRSTYIRSDDYLLRPGQFKYIPFEPIHAETRFVAVIADYRGHENASWRQVLR
IPPRGRQIMLSVLVNDTHIVLKEED
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcatccacttctgctcgccaccctgttgcttgcgctggtcgtgcccaccggc
tgtacctctttgagcagaatgagccaggtggccatggaccactcgttgcccatcgggccg
cccaaggatcacccgaccgaggtcgcattcagcatcaatgccagccctaccctcaacggc
aatccgaacagccttgacgtcgcagccgaacaggatagcgccctggagcccagcccctac
gctgtaaccctgagtgctggcgacccctatgcgttgaccgaaaaaatcggggttctgttc
gaatacctgcaagcgcaattcccggccatgtcccccgtcgagctggacgaaggagacgaa
agcgacccggcgcgctcacccctggaagaaagcggccccggcagctacgacgaccctcag
gtggcgttgaccttgccgcgcaccacaagcgttgcctcagcgctggtcgccacgcccatt
gccatcacgatcctgcaactgcgcgacgactcactgctgcgcaacaccgtgtaccagcta
ctggagcaggacccggccaaggcgctgcgcagtacctacatccgcagtgacgattacctg
ctgcgccctggccagttcaagtacatcccgttcgagcctatccacgccgaaacccgcttc
gtcgcggtgattgccgattaccgagggcatgaaaacgccagttggcggcaagttctgcgc
attccgccgcgtggccgccagatcatgctgtcggtgctggtcaacgacacgcacatcgtg
ctcaaggaagaagactga

DBGET integrated database retrieval system