KEGG   Pseudomonas putida ND6: YSA_01549Help
Entry
YSA_01549         CDS       T02170                                 

Definition
(GenBank) Ribosomal RNA large subunit methyltransferase M
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ppi  Pseudomonas putida ND6
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppi03009]
    YSA_01549
Enzymes [BR:ppi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     YSA_01549
Ribosome biogenesis [BR:ppi03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    YSA_01549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: AFK67616
UniProt: I3UQ45
Position
complement(808070..809134)
Genome map
AA seq 354 aa AA seqDB search
MNTLFMHCRPGFEGEVCAEISEHAARLGVAGYAKGKPQSASAEFVCSEEGGAERLMGELR
FNQLIFPRQWARGGYVELPESDRISVLLAQLADFPVFGSLWLEVLDSNEGKELSTFCRKF
EVPLRKALEKAGRLVDDPGRPRLLLTFISGRRVFVGVASASNSALWPMGIPRLKFPREAP
SRSTLKLEEAWHQFIPREQWEQRLGDDMTGVDLGASPGGWTYQLVRRGMLVTAIDNGPMA
ESLMDTGLVQHLMADGFTWQPKQPVDWMVCDIVEKPARTTSLIETWLGEGLCREAVVNLK
LPMKQRYAEVRRLLDRMEATFKARKIRVSIACKQLYHDREEVTCHLRRLDLKPR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaataccctgttcatgcattgccggcccggtttcgagggtgaggtttgcgccgaaatc
agcgaacatgccgcccgcctgggtgttgccggctatgccaaaggcaagccgcaaagtgcc
agtgccgagtttgtctgtagcgaggagggcggtgccgagcgcttgatgggggaactgcgt
ttcaaccagctgattttcccgcggcagtgggcacgtggcggttacgttgaactgccggaa
agtgaccgcatcagtgtgttgctggcgcagttggccgatttcccggtgttcggcagcctt
tggctggaggtgctggacagcaacgaaggcaaggaattgtccaccttctgccgaaagttc
gaagtgccgttgcgcaaggccctggagaaggccggccgcctggtcgacgaccccggtcgc
ccacgcttgctgctgaccttcatcagcggccggcgggtatttgtcggcgtggcatcggcc
agcaacagcgccttgtggcccatgggcatcccgcgcctgaagtttcctcgcgaggcacct
agccgttcgacactcaagctggaagaggcctggcaccagttcattccgcgtgagcagtgg
gagcagcgcctgggggatgacatgaccggcgtcgacctgggagcctcaccgggtggctgg
acctaccagctggtgcgccgtggcatgctggtgacagccatcgataacgggccgatggcc
gaaagcctgatggacacaggcctggtccagcacttgatggccgatgggtttacctggcag
ccgaagcagccggtagactggatggtgtgcgatatcgtcgagaagccggcgcgtaccacc
tcgctgattgaaacctggctgggtgaggggctgtgccgcgaggcggtggtcaacctgaag
ttgccgatgaagcagcgttatgccgaagtacggcgcctgctcgaccgtatggaggcaaca
ttcaaggcacgcaagatcagggtgtcgattgcctgcaagcagctgtaccacgaccgtgaa
gaagtaacctgccacctgcggcggctcgacttgaagccacgctga

DBGET integrated database retrieval system