KEGG   Pseudomonas putida ND6: YSA_01683Help
Entry
YSA_01683         CDS       T02170                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00071  Fatty acid degradation
ppi00072  Synthesis and degradation of ketone bodies
ppi00280  Valine, leucine and isoleucine degradation
ppi00310  Lysine degradation
ppi00362  Benzoate degradation
ppi00380  Tryptophan metabolism
ppi00620  Pyruvate metabolism
ppi00630  Glyoxylate and dicarboxylate metabolism
ppi00640  Propanoate metabolism
ppi00650  Butanoate metabolism
ppi00900  Terpenoid backbone biosynthesis
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01120  Microbial metabolism in diverse environments
ppi01130  Biosynthesis of antibiotics
ppi01200  Carbon metabolism
ppi01212  Fatty acid metabolism
ppi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YSA_01683
   00630 Glyoxylate and dicarboxylate metabolism
    YSA_01683
   00640 Propanoate metabolism
    YSA_01683
   00650 Butanoate metabolism
    YSA_01683
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YSA_01683
   00072 Synthesis and degradation of ketone bodies
    YSA_01683
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YSA_01683
   00310 Lysine degradation
    YSA_01683
   00380 Tryptophan metabolism
    YSA_01683
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YSA_01683
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YSA_01683
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YSA_01683
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppi04147]
    YSA_01683
Enzymes [BR:ppi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     YSA_01683
Exosome [BR:ppi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YSA_01683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C PulG
Motif
Other DBs
NCBI-ProteinID: AFK67690
UniProt: I3UQB9
Position
complement(889978..891162)
Genome map
AA seq 394 aa AA seqDB search
MKDAVIVATARTPIGKAMRGAFNDLKTPSMTAVAIRAAVERAGIEPAQVDDLVLGTAMQS
GTAAINPGRLSALAAGLPQTVSGQTVDRQCASGLMAIATAAKQIMVDGMQVTIGAGQEQI
SLVQQVHNQLASEAYDPAVLRMSEHAYMPMLQTAERVARRYGISREAQDVYALQSQQRTA
AAQAAGLFAAEIVPVTARKKVVDKLTGVVSHEEVRLIQDEGNRPATTLADLQGLKPVVEG
GCVTAGNASQLSDGASACVLMEGALAARSGIAALGLYRGIAVAGLAPEEMGIGPVLAVPK
LLRQQGLTVDDIGLWELNEAFACQVLYCAQQLQIDPAKLNVNGGAIAIGHPYGMSGARMV
GHALLEGKRRKVKYVVVTMCVGGGMGAAGLFEVL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgccgtgatcgtcgccactgctcgcacccctatcggcaaagccatgcgtggc
gccttcaacgacctgaaaacccccagcatgacggctgtcgctatccgcgccgcggtagaa
cgtgccggtatcgaaccggcgcaggtcgatgacctggtgctggggactgccatgcagagc
ggcactgccgcgatcaacccgggtcggctgtcggcgctggccgccggcctgccccaaacg
gtcagcggtcagaccgtcgaccgccagtgcgcttcaggcctgatggccattgccacggcg
gcgaagcagatcatggttgatggcatgcaagtgaccattggcgcaggccaggagcagatc
agcctggtgcagcaggtgcacaaccagctggccagtgaggcttacgaccccgcagtgctg
cgcatgagcgagcacgcctacatgccgatgttgcaaacggccgaacgggtggcccggcgt
tatggcataagccgcgaagcacaggatgtctacgccctgcagtctcagcagcgcacggcg
gcggcgcaggcggcagggttgttcgccgctgaaatcgtgccggtcaccgcacgcaagaag
gtggtggacaagctgacaggtgttgtcagccatgaagaggtgcgcctgatccaggacgaa
gggaaccgaccggcgacgaccctggccgatctacaggggctcaagcccgtggtcgaaggc
ggttgtgtcacggccggcaatgccagtcagttgtccgatggcgccagtgcctgcgtgctg
atggagggcgcgctggcggcgcgctcgggcatcgcagccctggggctttaccgcggtatc
gccgtggctggccttgcccccgaggaaatgggcatcggcccggtattggcggtgcccaag
ctactgcgccaacagggcctgacggtagacgatatcgggctatgggagctgaacgaggcg
tttgcctgccaggtgctgtattgcgcccagcagttgcagatcgacccggcgaaactgaac
gtcaatggcggcgccattgctatcggccacccctacggcatgagcggcgcgcggatggtc
ggccatgccttgctggagggcaagcgacgtaaggtgaagtacgtggtcgtgacgatgtgc
gtgggcggcggcatgggcgcagcaggcctgttcgaagtgctttag

DBGET integrated database retrieval system