KEGG   Pseudomonas putida ND6: YSA_02272Help
Entry
YSA_02272         CDS       T02170                                 

Definition
(GenBank) asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00250  Alanine, aspartate and glutamate metabolism
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YSA_02272
Enzymes [BR:ppi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     YSA_02272
Peptidases [BR:ppi01002]
 Cysteine Peptidases
  Family C44
   YSA_02272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: AFK67996
UniProt: I3UR75
Position
1224244..1226031
Genome map
AA seq 595 aa AA seqDB search
MCGLAGELRFTPIDQAPRPADLAAVERITHHLAPRGPDAWGFHSQGPIALGHRRLKIMDL
SDGSAQPMIDNTLGLSLAFNGAIYNFPELREELQALGYSFWSDGDTEVLLKGYHAWGAAL
LPKLNGMFALAIWERDNQRLFLARDRLGVKPLYLSRNGERLRFASTLPALLKGGDIDPML
DPVALNHYLNFHAVVPAPRTLLANVQKLEPGTWMRIDRHGEVERQTWWQLKYGPHPDERE
LDLEGWTTRVLDATRDAVAIRQRAAVDVGVLLSGGVDSSLLVGLLREVGVDDLSTFSIGF
EDAGGERGDEFQYSDLIAKHYGTRHHQLRIAEHEIIDQLPAAFRAMSEPMVSHDCIAFYL
LSREVAKHCKGVQSGQGADELFAGYHWYPQVDGADDAYAAYREAFFDRSHAEYRDTVQAP
WLLETDAAGDFVREHFARPGAPAAVDKALRLDSTVMLVDDPVKRVDNMTMAWGLEARTPF
LDYRLVELSARIPARFKLPDGGKQVLKQAARRVIPHEVIDRKKGYFPVPGLKHLEGATLG
WVRELLTDPSQDRGLFNPAMLDRLLSNPHGQLTPLRGSKLWQLAALNLWLSEQGI
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggattagcaggagagttacgtttcacccccatcgaccaagcccctcgcccagcc
gacctggctgcggtagagcgcattacccatcacctggccccgcgtggcccggatgcctgg
ggcttccatagccaaggcccgatcgccctgggccaccggcgcctgaagatcatggacctg
tccgacggctcggcgcagccgatgatcgacaatacgctgggcctgtcgctggccttcaac
ggtgccatctacaacttccccgaactgcgcgaggaattgcaggcgctgggctacagcttc
tggtccgacggcgacactgaggtgctgctcaagggctaccacgcctggggcgcggcgctg
ctgcccaagctcaacggcatgtttgccctggccatctgggagcgcgacaaccagcgcctg
ttcctggcccgcgaccgcctgggcgtcaaacccctgtacctgtcgcgcaacggcgagcgc
ctgcgctttgcctcgaccctgccggcactgctcaagggcggcgacatcgacccgatgctc
gaccccgtggccctcaaccactacctgaacttccacgccgtggtaccggcaccgcgcacc
ctgctggccaacgtgcagaagctggagcccggcacctggatgcgcatcgaccgccatggc
gaagtggaacgccagacctggtggcagctgaagtacggcccccaccccgacgagcgtgaa
cttgatctggaaggctggaccacccgcgtactcgacgccacccgcgacgccgtagccatc
cgccagcgggcagccgtcgatgtgggtgtgttgctgtccggcggtgtcgattccagcctg
ctggtcggcttgctgcgcgaagtgggcgttgacgacctgtcgaccttctccatcggcttt
gaagatgccggcggcgagcgtggcgacgagttccagtattcggacctgatcgccaaacac
tacggcacccgtcaccaccagttgcgcattgccgaacacgaaatcatcgaccaactgccg
gccgccttccgcgccatgagcgagccgatggtcagccacgattgcatcgcgttctacctg
ctgtcgcgggaagtggccaaacactgcaaaggcgtacagagcggccagggtgccgatgag
ctgttcgccggttaccactggtacccgcaggtggacggcgcggacgatgcctatgcggcc
taccgtgaggcgttcttcgaccgcagccacgccgaataccgcgacaccgtgcaggccccc
tggctgctggaaaccgacgctgccggcgacttcgtgcgcgaacacttcgcgcgccccggc
gcaccggctgccgtggacaaggccctgcgcctggacagtaccgtgatgctggtcgacgac
ccggtcaagcgggtggacaacatgaccatggcctggggcctggaggcgcgtacgccgttc
cttgattaccgcctggtggaactgtcggcacgcattcccgcacgcttcaagctgcccgac
ggcggcaagcaggtgctaaagcaggcagcgcgacgggtgatcccgcatgaggtgattgac
cgcaagaagggttacttcccggtaccgggcctgaagcatctggaaggtgccaccttgggc
tgggtacgcgaactgttgaccgaccccagccaggaccgagggttgttcaacccggccatg
ctcgaccgcctgctgagcaacccacacggccagctgacgccattgcgcggttccaagctg
tggcaactggcggcgctgaacctgtggctgagcgaacaaggaatctga

DBGET integrated database retrieval system