KEGG   Pseudomonas putida ND6: YSA_03231Help
Entry
YSA_03231         CDS       T02170                                 

Definition
(GenBank) oxidoreductase FAD/NAD-binding subunit
  KO
K00528  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09112 Not included in regular maps
   09113 Global maps only
    YSA_03231
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YSA_03231
Enzymes [BR:ppi01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     YSA_03231
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     YSA_03231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-ProteinID: AFK68522
UniProt: I3USQ1
Position
complement(1745259..1746113)
Genome map
AA seq 284 aa AA seqDB search
MRPYKAVVFILATLGDTVHTPTLEPDMTASAEKFTRQTLLDVKPLTPNLFSLRVTRDAGF
RFRSGQFARLGVTKADGSVVWRAYSMVSAPHDEHLDFFSIVVPGGEFTSELSRLGAGDTL
LIDRQAFGFLTLDRFVGGRDLWLLATGTGIAPFMSILQDFEAWERFDSIKLVYSVREAKE
LAYVDEIAGLEQRDYLAEYAGKLQFIPVVTREQHPGALNQRITTLIENGELERAAGLELS
PEHSRVMLCGNPEMIDETRKVLKARDLQLSLSKRPGQVAVENYW
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaggccctacaaagcggtggtttttatcctggccactttaggcgacactgtgcacacg
ccaaccctggagcccgatatgaccgctagcgccgaaaagttcactcgccagacactgctt
gatgttaagccactgacgccgaacctcttcagcctgcgggttacgcgcgatgcggggttc
cgcttccgttccggccaattcgcccggctaggtgtgaccaaggccgatggtagtgtggtg
tggcgcgcctattccatggtcagcgccccccatgacgagcacctggatttcttttccatc
gtggtgccaggtggtgagttcaccagtgagctgagccgtttgggtgcaggcgatacgttg
ctgatcgaccgccaggcgttcggtttcctcaccctcgaccgcttcgtcggtggtcgtgac
ctgtggctgctggctaccggtaccggcattgcgccattcatgtctatcctccaggacttt
gaggcctgggagcgcttcgacagcatcaagctggtgtattcagtgcgcgaagcgaaggag
ctggcctatgtggatgaaattgccgggctggaacagcgcgattacctggccgagtacgcg
ggcaagttgcagttcattcccgtggtgacccgtgaacaacaccctggggcgttgaatcag
cggattacgacgttgatcgagaatggcgagctggagagggcggcagggcttgaactgtcg
ccagagcattctcgtgtgatgctgtgcggtaacccggaaatgatcgacgaaacccgcaag
gtcctcaaggcgcgcgacctgcaattgagcctgagcaagcggccggggcaggtggcagtc
gagaactactggtaa

DBGET integrated database retrieval system