KEGG   Pseudomonas putida ND6: YSA_03364Help
Entry
YSA_03364         CDS       T02170                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00010  Glycolysis / Gluconeogenesis
ppi00620  Pyruvate metabolism
ppi00640  Propanoate metabolism
ppi00680  Methane metabolism
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01120  Microbial metabolism in diverse environments
ppi01130  Biosynthesis of antibiotics
ppi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YSA_03364
   00620 Pyruvate metabolism
    YSA_03364
   00640 Propanoate metabolism
    YSA_03364
  Energy metabolism
   00680 Methane metabolism
    YSA_03364
Enzymes [BR:ppi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YSA_03364
Lipid biosynthesis proteins [BR:ppi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YSA_03364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFK68592
UniProt: I3USX1
Position
1820294..1822228
Genome map
AA seq 644 aa AA seqDB search
MFDIRKYPQALAVSQSAALTPEDYRRLYRQSVEDPDTFWAEQAKRLDWIKPWSSVQQCDL
HTGKARWFDGAQLNVSYNCIDRHLAQRGEQTALLWEGDDPKDSKAITYRELHREVCRLAN
AMKARGVKKGDRVCIYMPMIPEAAFAMLACTRIGAIHSVVFGGFSPDALRDRILDADCRT
VITADEGVRGGKRIPLKQNVDKALASCPAVSSVLVVRRTGGDVAWTEGRDLWYHEATKDA
GDDCPPEPMEAEDPLFILYTSGSTGKPKGVLHTTGGYLLQATMTFKVVFDYRDGEVFWCT
ADVGWVTGHSYIVYGPLANGAISLMFEGVPNYPDTSRFWQVVDKHQVNIFYTAPTALRAL
MREGSAPLQGTSRKSLRLLGSVGEPINPEAWEWYFEEVGQKRCPIVDTWWQTETGGIMLT
PLPGTQSLKPGCATQPMFGVQPVLLDEKGKLIEGPGAGVLAIKASWPGQIRSVYGDHQRM
VDTYFKPLPGYYFTGDGARRDADGDYWITGRIDDVINVSGHRIGTAEVESALVLHDSVAE
AAVVGYPHDLKGQGVYAFVTTMNGVTPDDTLKAELLALVSKEIGSFAKPELIQWAPALPK
TRSGKIMRRILRKIACNELENLGDTSTLADPSVVQGLIDKRLNQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatatccgcaaatacccccaagccctggccgtcagccagtccgccgccctcacc
cccgaagactaccgccgcctctaccgccagtcggtcgaagacccagacaccttctgggcc
gaacaggccaaacgtctggactggatcaagccttggtcaagcgtgcagcaatgcgacctg
cataccggcaaggcccgctggttcgacggtgcgcaactcaacgtcagctacaactgcatc
gaccgtcatctggcccagcgcggcgagcaaacggccctgctgtgggaaggcgacgacccc
aaggattccaaggccatcacctatcgcgaactgcaccgtgaggtctgccgcctggccaac
gcaatgaaagcgcgcggtgtgaagaaaggcgaccgggtgtgcatctacatgccaatgatt
cccgaggccgccttcgccatgctcgcctgcacccgcatcggcgccatccactcggtagtg
ttcggcggtttctcccccgatgccttgcgagaccgtattctcgatgccgactgccgcacc
gtgatcaccgccgatgaaggcgtgcgtggcggcaaacgcatcccgctgaaacagaacgtc
gacaaggccctggccagctgccctgcggtcagtagcgtattggtggtgcgtcgcactggc
ggcgatgttgcgtggaccgagggccgcgacctctggtatcacgaagcgacgaaggatgcc
ggcgacgactgccccccagaaccgatggaggccgaagacccgctgttcatcctctacacc
tccggcagcaccggcaaacccaaaggggtgctgcataccaccggcggctacctgctgcag
gcaacgatgaccttcaaggtggtgttcgattatcgtgacggcgaggtgttctggtgcacc
gccgatgtcggctgggtgactggccacagctacatcgtctacggcccgctggccaatggc
gcaatctcgctgatgttcgaaggcgtgcccaactacccggatacctcgcgcttctggcag
gtggtggacaaacaccaggtgaacatcttctacaccgccccgaccgccctgcgcgcactg
atgcgcgagggctctgcgccactgcagggcacctcacgcaaaagcctgcgcctgctgggc
agcgtcggcgagccgatcaacccggaagcctgggaatggtatttcgaggaggtcgggcag
aagcgctgcccgattgtggatacctggtggcagaccgaaaccggcggcatcatgctcacc
ccgctgcccggcacgcagtcactcaaacccggctgcgctacccagccaatgttcggcgtg
cagccggtgctactggacgaaaaaggcaaactgatcgaaggccccggcgccggcgtgctg
gcgatcaaagccagctggccggggcagatccgcagtgtctacggcgaccaccagcggatg
gtcgacacctacttcaagcccttgcccggctactacttcacaggcgacggtgcccgccgc
gatgccgatggcgactactggatcaccgggcgcatcgacgatgtgatcaacgtatccggg
caccgcatcggcaccgctgaagtggaaagcgcacttgtgctgcatgacagcgtggccgaa
gccgcggtggtcggttatccccacgacctcaagggccaaggcgtctacgccttcgtcacg
accatgaatggcgtgacaccagatgacacgctaaaagccgagctgctggccctggtcagc
aaggaaatcggcagcttcgccaagcctgagctgattcagtgggcgccagcgctacccaag
acgcgctcaggcaagatcatgcggcgtatactgcgcaaaatcgcctgcaatgagctggaa
aacctgggcgatacctcgaccctggccgacccaagcgtggtacagggcctgatcgacaaa
cgcctcaaccagtaa

DBGET integrated database retrieval system