KEGG   Pseudomonas putida ND6: YSA_07102Help
Entry
YSA_07102         CDS       T02170                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00010  Glycolysis / Gluconeogenesis
ppi00052  Galactose metabolism
ppi00500  Starch and sucrose metabolism
ppi00520  Amino sugar and nucleotide sugar metabolism
ppi00521  Streptomycin biosynthesis
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01120  Microbial metabolism in diverse environments
ppi01130  Biosynthesis of antibiotics
ppi01200  Carbon metabolism
Module
ppi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YSA_07102
   00052 Galactose metabolism
    YSA_07102
   00500 Starch and sucrose metabolism
    YSA_07102
   00520 Amino sugar and nucleotide sugar metabolism
    YSA_07102
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    YSA_07102
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    YSA_07102
Enzymes [BR:ppi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     YSA_07102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK Pan_kinase
Motif
Other DBs
NCBI-ProteinID: AFK70606
UniProt: I3UYN5
Position
3839921..3840880
Genome map
AA seq 319 aa AA seqDB search
MKHLLVGDIGGTNARFALWRDNQLHEVNVFATADYTNPEQAIEAYLESQGIARGGLAAVC
LAVAGPVDGDEFRFTNNHWRLSRTAFCKTLEVERLLLINDFTAMALGMTRLREGEFREVC
PGQADPSRPALVIGPGTGLGVGSLLRLGEQHWKALPGEGGHVDLPVGNAREAAIHQQIHS
QIGHVSAEAVLSGGGLVRLYQAICALDGDTPRHKTPAHITDAALGGEPRALAVVEQFCRF
LGRVAGNNVLTLGARGGVYIVGGVIPRFAELFLRSGFAASFADKGCMSGYFTGVPVWLVT
AEYSGLEGAGVALQQALDH
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacctgctggttggtgatattggcggcaccaatgcccgttttgcgttgtggcgt
gacaaccagctgcatgaggtaaacgttttcgccaccgcggactacaccaaccccgagcag
gccatcgaggcctacctggaaagccaaggtatcgcccgtggtggcctggcggcggtgtgc
ctggcggtggccggcccggtcgatggcgatgaatttcgcttcaccaacaaccactggcgc
ctgagccgcacggcattttgcaagaccttggaggtcgagcgactgttgctgatcaatgat
ttcaccgctatggcgctgggcatgacgcgtctgcgcgaaggcgagttccgcgaggtgtgc
cccggccaggccgacccctcgaggccggcactggtgatcgggccaggtactggcctgggt
gtgggctcgctgctgcgtctgggcgaacagcactggaaggccctgccgggtgaaggcggg
catgttgacctgccggtaggcaatgctcgcgaagcggcaatccaccagcagatccacagt
cagatcggccatgtcagcgccgaggccgttctcagtgggggggggctggtgcggttgtac
caggcgatctgtgcgctggacggcgacacgcccaggcacaagaccccggcgcatatcacc
gacgccgcactgggcggtgagccacgggcgctggcggtggtcgagcagttctgtcgtttc
cttgggcgcgtggcgggtaacaatgtgctgacgctgggcgcgcgaggcggggtctatatt
gtgggcggtgtgattccgcgctttgccgagctgttcctgcgcagcgggtttgccgcgagt
tttgccgacaaggggtgtatgagtggctatttcaccggggtgccggtgtggctggtgacg
gcggaatattccgggttggagggggcaggggtagcgttgcagcaggcgttggatcactga

DBGET integrated database retrieval system