KEGG   Pseudomonas putida ND6: YSA_07920Help
Entry
YSA_07920         CDS       T02170                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00790  Folate biosynthesis
ppi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YSA_07920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppi04147]
    YSA_07920
Enzymes [BR:ppi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     YSA_07920
Exosome [BR:ppi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YSA_07920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AFK71060
UniProt: I3UZY9
Position
complement(4280233..4280589)
Genome map
AA seq 118 aa AA seqDB search
MNALNQAHCEACRADAPKVTDEELAELIREIPDWNIEVRDGHMELERVFLFKNFKHALAF
TNAVGEIAEAEGHHPGLLTEWGKVTVTWWSHSIKGLHRNDFIMCARTDKVAETAEGRK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccttgaaccaagcccattgcgaagcctgccgcgccgacgcaccgaaagtcacc
gacgaagagctggccgagctgatccgcgaaatcccggactggaacatcgaagtacgtgac
ggccacatggagctggagcgcgtgttcctgttcaagaacttcaagcacgccctggcgttc
accaatgccgtgggcgaaattgccgaagccgaaggccaccacccagggctgctgactgaa
tggggcaaggtcaccgtgacctggtggagccactcgatcaaaggcctgcaccgcaacgac
ttcatcatgtgcgcacgcactgacaaggtggcggaaacggctgaaggccggaagtaa

DBGET integrated database retrieval system