KEGG   Pseudomonas putida ND6: YSA_10449Help
Entry
YSA_10449         CDS       T02170                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi02025  Biofilm formation - Pseudomonas aeruginosa
ppi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YSA_10449
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    YSA_10449
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppi02044]
    YSA_10449
Secretion system [BR:ppi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YSA_10449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AFK72435
UniProt: I3V3W4
Position
complement(5581751..5582293)
Genome map
AA seq 180 aa AA seqDB search
MLLMESFTMAFDAYIQIDGIPGEVLDEKHKDWIEVLGYEYGATQATSATASSSGGASSER
VALSDFKIRKAVDKASAKLFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVK
FVAGGNQNGEDKAVSDLPVEEISFNFARIKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgttgttaatggagagtttcacaatggcatttgacgcgtatatccaaatcgacggcatc
ccaggtgaagtactggatgaaaaacacaaggactggatcgaagtgctgggctacgagtac
ggcgccacacaggctacgtcggcaaccgccagctcttcgggcggtgcgtcctccgagcgc
gttgccctgagcgacttcaagatccgcaaggcagtcgacaaggcatcggccaaactgttc
gaacactgctgcaccggcaagcacatcgccaagctgaagctgaacgtgaaccgcgccggt
ggtgacaaggtcacctacctgaccatcgacatggaagaagtggtggtctcttcggtcaag
tttgtcgccggtggcaatcagaatggtgaagacaaggcggtcagcgacctgcccgttgaa
gaaatcagcttcaactttgcccgcatcaagaccacctacacccagcagaaccgtaccgac
ggccaggccggcggcaacatcgtgggtggctgggaccgcaccgcgaacaaagtgtttgcc
taa

DBGET integrated database retrieval system