KEGG   Pseudomonas putida ND6: YSA_10459
Entry
YSA_10459         CDS       T02170                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    YSA_10459
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppi02044]
    YSA_10459
Secretion system [BR:ppi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YSA_10459
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AFK72440
UniProt: I3V3W9
Position
complement(5590357..5591700)
AA seq 447 aa
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAEATLRSTPFHWGVQALQVDEDALANGSL
QLKRLKLVFPDGSLYDAPQHDPLPAARDLKDLLKANDLKVYAALKLPEPFGLNYVEDGHE
HKAARRFRKQFDTLPDLNEGELENEITSLRLNVVLLVDGDSLDGYSHCPLAKLTRNSMGG
FNVDPHFVHPTLHLGSHETIAGIGKRLLGALQAKSKALSGRRRERADQIAEFGSSDVTLF
WLLNTVNRAHPQLAHLLAHPRLHPERLYLFLADLAGGLLTFTLDTQLSDIPEYDHHDPAA
SLVKLDEMIRVMLDNVVPNQCIVINLTQTKPSHWQGQLHDPRLAEADFYIAVHADMPGAS
LLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHAARLPNAIPVRLDNQYFAIEPHGTVYER
MISAQAICFYAPSAFTNLKLELMAVLK
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagcaagcagagccgggtgatgtggtcggaaggcatgttcctgctgccccagcacttc
cagtatcaggacgaattccatcagcaccagttggctgaggcgaccctgcgcagcacccct
ttccattggggggttcaggcgctgcaggtggacgaggacgccctggccaatggttcactg
cagctcaagcgcctgaagctggtgttccccgatggcagcctctacgacgcgccgcagcac
gatccgctgccggccgcgcgcgacctcaaggacctgctcaaggccaacgacctgaaggtg
tatgccgcgctcaagctgcccgagccattcggcctcaactacgtcgaggatggccatgaa
cacaaggccgcacggcgtttccgcaagcagttcgacaccctgcccgaccttaatgaaggc
gaactggaaaacgaaatcaccagcttgcgcctgaacgtcgtgctgctggtcgacggtgac
agcctcgacggttacagccactgcccactggccaagctgacacgcaacagcatgggcggt
ttcaacgttgacccacatttcgtccaccccaccttgcacctgggcagccacgagaccatt
gccggcatcggcaagcgcctgctcggcgccctgcaggccaagagcaaggcgctttccggc
cgacgccgcgagcgcgccgaccagatcgccgagttcggctccagcgatgtgaccctgttc
tggctgctgaacacggtcaaccgtgcccacccgcagctggcgcatctactggcccacccg
cgcctgcacccggagcgcctgtacctgttcctggcggaccttgccggcggcctgctgacc
ttcaccctggacacccagctcagcgacatccccgagtacgaccaccacgacccggccgcg
tcgctggtcaagctcgacgaaatgatccgggtgatgctcgacaacgttgtgcccaaccag
tgcattgtcatcaacctgacccagaccaagccatcgcactggcaaggccaactgcacgac
ccgcgcctggccgaagccgacttctatatcgccgtgcacgccgacatgcccggcgccagc
ctgctggagctggtgccccgtgccttcaaggtcggttcgccggaagacattgaagtggtg
gtcaacagcgccatgccgggtgtcaccctcaatcatgccgcgcggctgccgaacgcaatt
ccggtgcgcctggacaaccagtacttcgccatcgagccacacggcactgtgtatgagcga
atgatcagcgcccaggccatctgcttctatgcgcccagcgcctttaccaacctcaagctt
gaactgatggcggtgctcaaatga

DBGET integrated database retrieval system