KEGG   Phaeobacter piscinae: PhaeoP14_00109Help
Entry
PhaeoP14_00109    CDS       T05105                                 

Definition
(GenBank) putative aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ppic  Phaeobacter piscinae
Pathway
ppic00350  Tyrosine metabolism
ppic00360  Phenylalanine metabolism
ppic00380  Tryptophan metabolism
ppic01100  Metabolic pathways
ppic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PhaeoP14_00109
   00360 Phenylalanine metabolism
    PhaeoP14_00109
   00380 Tryptophan metabolism
    PhaeoP14_00109
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppic04147]
    PhaeoP14_00109
Enzymes [BR:ppic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     PhaeoP14_00109
    4.1.1.105  L-tryptophan decarboxylase
     PhaeoP14_00109
Exosome [BR:ppic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PhaeoP14_00109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DUSP MoCF_biosynth Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ATG38244
UniProt: A0A291FJK7
Position
complement(126446..127855)
Genome map
AA seq 469 aa AA seqDB search
MNWSDFSHWGRKIADWTQHYHQTVGDRPVRARTEPGDVLNALPATPPEAGEGMETIFADF
ETVVMPGITHWQHPRFFAYFTSNAAAPSVLAEFLTSAIAPQCMLWQTSPAATEMETRMMD
WLRQALDLPEEFQGVIQDSASSATLAAVLTMREKALNWQGNEQGLFSQKTLRIYCSSEVH
TSVDRAIWVAGIGQQNLVRVPIKGDWRGMDPDALTAAIEADIAAGHQPAGVILCVGGTGV
GATDPVDQILDVAENYGLYTHVDAAWAGSAMICPEYRHYWPGIERADSIVFNPHKWLGVQ
FDCSAHFLKNPDDLVRTLAISPEYLKTHGKDGIINYSEWSVPLGRRFRALKIWFLIRTYG
LEGLRQRLRNHVTWSQQLHDRLQLEPDFEIVTPPMWSLWSFRYQPDGAKDLDDLNLRLVN
AINDDGRIYLTQTRVDGALVIRFQAGQFETTEADVMMAHDVITEIARTL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaactggtctgatttttcccattggggtcgcaagattgccgactggacccaacactac
catcagacggttggtgacaggccggtgcgcgccagaaccgaacccggtgacgttctgaat
gcgcttcccgccacgccgcccgaagctggcgaaggcatggagaccatctttgccgatttt
gaaaccgttgtgatgcccggaatcacccattggcagcatccacggttctttgcctatttc
acctccaatgccgctgccccatcggtgcttgcggaattcctcacctctgccatcgcgccg
caatgcatgctctggcagacctctcctgcggcgacggaaatggaaacccgcatgatggac
tggctgcgccaggcgcttgacctgccagaagagtttcagggcgtcattcaggacagtgcc
tcttccgccaccctggcagccgtcctcacgatgcgggaaaaggcgctgaactggcagggc
aatgagcaggggctattttcccagaagactttgcgcatctactgctcttcggaggtgcac
acctccgtcgatcgtgccatctgggttgccggtatcggccagcaaaatcttgtccgtgtt
ccgatcaaaggggactggcgcggcatggacccggacgcgctgaccgcagcaattgaggcc
gacatcgcggccggccaccagcccgccggcgtcatcctctgtgtcggaggcaccggagtt
ggcgccaccgacccggtcgatcagatactcgatgtggctgaaaattatggtctctatacc
catgtggatgccgcctgggccggctccgccatgatttgccccgaataccgccattactgg
cccggaattgagcgcgcagacagcatcgttttcaacccgcacaaatggctgggggtgcaa
tttgattgttccgcccatttcctgaaaaatcccgacgatctggtccgaacgctggccata
agccccgaatatctcaaaacccatggcaaagacggcatcatcaactactctgaatggtcg
gtgcccctgggccgccgtttccgtgcgctcaaaatctggttcctgatccggacctacggt
ctggaagggctgcgccaacggttgcgcaaccatgtgacatggtcacagcaattgcatgat
cggctccagttagagcctgatttcgagatcgtgacgccgccaatgtggtctctctggtcc
tttcggtatcagcccgatggagccaaggatctggacgatctgaatctgcggttggtgaat
gcgatcaacgacgatggccgcatttacctgacccagacccgcgtcgatggcgctctggtg
atccgttttcaggcagggcaatttgaaacaaccgaagccgatgtcatgatggcacatgat
gtcatcactgaaatcgcccgaacgctatag

DBGET integrated database retrieval system