KEGG   Phaeobacter piscinae: PhaeoP14_00379Help
Entry
PhaeoP14_00379    CDS       T05105                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
ppic  Phaeobacter piscinae
Pathway
ppic00361  Chlorocyclohexane and chlorobenzene degradation
ppic00625  Chloroalkane and chloroalkene degradation
ppic01100  Metabolic pathways
ppic01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppic00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PhaeoP14_00379
   00361 Chlorocyclohexane and chlorobenzene degradation
    PhaeoP14_00379
Enzymes [BR:ppic01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     PhaeoP14_00379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like Hydrolase_6 HAD
Motif
Other DBs
NCBI-ProteinID: ATG38511
Position
complement(414303..414989)
Genome map
AA seq 228 aa AA seqDB search
MAITTCIFDAYGTLFDVTAAARQAAQEPEFPHLIDHWAELANHWRLKQLQYTWLRAITNA
YTDFWQVTQDGLDWAMDATGLSGDPQLRKRLLDLYWQLQAYEEVPQMLRALKTAGLQTAI
LSNGSPKMLEGAVNSAGVSGLLDDVLSVEAVGVFKPDAQVYDLVEARFNCQRDEVLFVSS
NGWDAAGAAGYGFTTAWVNRSGEPMDRLPWTPHHILSDLSSIPTLLGT
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcacaacctgtatcttcgatgcctatggcacattgttcgacgtgacggcggcc
gcgcggcaagccgcacaggagccggagtttccgcatctgatcgaccattgggccgagctg
gccaatcactggcgactgaagcagctgcaatacacctggctgcgcgccatcaccaatgcc
tacacggatttctggcaggtcacccaagatggtttggactgggcgatggacgccaccggc
ctcagtggggatccgcaactccgcaaacggttgctcgatctctattggcagcttcaggcc
tatgaggaggtgccgcagatgttgcgcgcgctcaaaacggctgggctacagacagcgatc
ctgtccaatggatcacctaagatgctggaaggtgcagtaaactcggccggtgtgagcggg
ctgctggacgatgtcttgtctgtcgaggccgtcggggtcttcaaacccgatgcacaggtc
tacgacctcgtcgaggcacggttcaactgtcagcgcgacgaggtattgtttgtttcctcc
aacggctgggacgccgccggcgcggcggggtatggattcaccacagcctgggtcaatcgg
agcggtgaaccgatggatcgcctgccttggacaccacatcatatcctgagcgacctgagc
agtattccgacattgcttgggacataa

DBGET integrated database retrieval system