KEGG   Phaeobacter piscinae: PhaeoP14_01031Help
Entry
PhaeoP14_01031    CDS       T05105                                 

Gene name
argS
Definition
(GenBank) arginyl-tRNA synthetase ArgS
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
ppic  Phaeobacter piscinae
Pathway
ppic00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ppic00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PhaeoP14_01031 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppic01007]
    PhaeoP14_01031 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ppic03016]
    PhaeoP14_01031 (argS)
   03029 Mitochondrial biogenesis [BR:ppic03029]
    PhaeoP14_01031 (argS)
Enzymes [BR:ppic01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     PhaeoP14_01031 (argS)
Amino acid related enzymes [BR:ppic01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   PhaeoP14_01031 (argS)
Transfer RNA biogenesis [BR:ppic03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PhaeoP14_01031 (argS)
 Prokaryotic Type
   Other AARSs
    PhaeoP14_01031 (argS)
Mitochondrial biogenesis [BR:ppic03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PhaeoP14_01031 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1f tRNA-synt_1 tRNA-synt_1g tRNA-synt_1e NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ATG39145
Position
1106288..1108033
Genome map
AA seq 581 aa AA seqDB search
MNLFTDIRSLVLDCLNVMVAEGTLPEGLDFANVAVEPPRDAAHGDMATNAAMVLAKPAKM
KPRDIADALAGKLAADARVTSAEVAGPGFLNLRLDRSSWQSVLAAVLAEDIKFGRSDLGA
GKRVNVEYVSANPTGPLHVGHTRGAVFGDALASLLDFVGYDVTREYYINDGGGQVDVLAR
SVYLRYLEAHGQEVAFVDGTYPGDYLVPVGQALKEKVGDAYVDQPEDVWLEEIRNFATDA
MMDLIRADLASLGIQMDKFFSEKSLYGTGLIESALKSLDDKGLIYEGVLEPPKGKKPDDW
EPREQTLFKSTEHGDDVDRPVKKSDGAWTYFAPDIAYHYDKVERGFDMLIDIFGADHGGY
VKRMKAAVSALSDGKVPLDIKLCQLVKLFKDGQEFKMSKRAGTFVTLRDVVDAVGPDVTR
FMLLTRKNDQGFDFDLDKALEQSKDNPVFYVQYANARICSTLRKAAEAGIATDDATLAAA
DLSLLQDDAQLAVAKKLAEWPRLVEIAARTNEPHRVAFYLYDLASELHGLYHLGKTNEGL
RFVNESNPSATHAKMALAKAVSIVISAGLGILGVTPAQEMR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaacctctttaccgatatccgctcgctcgtgcttgactgcctcaatgtaatggtggct
gagggcaccctgcccgaagggctcgattttgccaatgtcgcggtagagccgccgcgcgat
gcggcgcatggggatatggcaaccaatgcggcgatggtgctggccaaacccgccaagatg
aagccgcgcgatatcgccgatgcgctggcagggaaactggccgcggacgcgcgcgtcacc
tcagccgaggtggcaggccccggtttcctcaacctgcgtctggatcgcagcagctggcaa
tcggtgctggcggccgtcctggcggaggatatcaaattcggtcgctccgacctcggcgcg
ggcaagcgggtcaatgtggaatatgtctccgccaaccccaccggccccctgcacgtcggc
cacacccgtggtgcggtgtttggcgatgcgctggccagcctgctggattttgtcggctat
gacgtcacccgcgaatactacatcaacgatggcggcggtcaggtcgatgtgctggcgcgc
tctgtttacctgcgctaccttgaggcgcacggccaagaggtcgcctttgtcgatggcaca
taccccggcgactatctcgtcccggttggtcaggcgctgaaggagaaggttggcgatgcc
tatgtggaccagcccgaagatgtctggctggaggagatccgcaatttcgccaccgatgcg
atgatggatctgatccgcgccgatctggcctcgcttggcatccagatggacaagttcttc
tccgagaaatccctctacggcactggcctgatcgaatccgcgctgaaaagcctggatgac
aagggcctgatctatgagggcgtgctggagccgccgaagggcaaaaagcccgacgattgg
gaaccacgcgaacagaccctgttcaaatccaccgaacatggtgatgacgtcgaccgcccg
gtcaagaaatccgatggcgcctggacctatttcgcgccggatatcgcctatcactatgac
aaggtcgaacgcggctttgatatgctgatcgacatcttcggcgccgaccacggcggctat
gtgaagcggatgaaagcagccgtctcagccctgtctgatggcaaggtgcccttggatatc
aagctctgccagctggtgaagctgttcaaggacggtcaggaattcaagatgtccaaacgg
gcagggacctttgtcaccctgcgcgacgtggtggatgcggtggggcccgatgtgacccgc
ttcatgctgctcacccgcaagaacgatcagggctttgacttcgatcttgataaggcgctg
gaacagtccaaggacaacccggtcttttatgtgcaatacgccaatgcgcggatctgctcg
accctgcgcaaggcggcggaggcggggatcgccaccgacgacgccacgctggccgctgcg
gatctgtcgctgttgcaggatgacgcccagttggctgtcgccaagaagttggcggaatgg
ccgcgtctggtggaaatcgccgcccgcaccaatgagccgcaccgcgtggccttctacctc
tacgatctcgcgtctgagctgcacgggctctaccacctcggcaaaaccaacgaaggttta
cgttttgttaacgagagcaacccatctgcaacacatgcgaaaatggcgctggccaaggcc
gtttccattgtcatttccgccggtcttggtattcttggggtcacaccggcgcaggagatg
cgatag

DBGET integrated database retrieval system