KEGG   Phaeobacter piscinae: PhaeoP14_02207Help
Entry
PhaeoP14_02207    CDS       T05105                                 

Definition
(GenBank) putative phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ppic  Phaeobacter piscinae
Brite
KEGG Orthology (KO) [BR:ppic00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PhaeoP14_02207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ATG40286
UniProt: A0A291G1X7
Position
2330953..2332434
Genome map
AA seq 493 aa AA seqDB search
MSDAPQRPQWKTLDRDLNRISQLELATSYVSRPLVAPGIALVFIALAGVGAAVFLGSAPS
NFVVIAAAAFGAYMALNIGANDVANNMGPAVGANALTMGGAIVIAALAESAGALLAGGDV
VSTISKGIIDPAGVASSEVFIWAMMAALISSALWVNLATWIGAPVSTTHSVVGGVMGAGI
AAAGFGAVNWPTMSKIAASWVISPVLGGVIAALFLAFIKAKIIYQDDKIAAARRWVPVLV
GIMAGAFASYLALKGLKRIIKIDLEIALLIGAAVGGLSYVVTAPLIKRQSEGMENRNKSL
KVLFSIPLVISAALLSFAHGANDVANAVGPLAAIVHTTEFGDIASKVAIPTWVMVIGAFG
ISFGLFLFGPKLIRMVGSQITKLNPMRAYCVSLSAAITVIVASWLGLPVSSTHIAVGAVF
GVGFFREWHMERRLKRSSATRPETKRIAPEERRRRKLVRRSHFMTIAAAWVITVPAAALL
SGCVFLALTAITM
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgcaccgcagcgaccgcagtggaagacactggaccgggatcttaaccggatc
tctcaacttgaactggcgacatcttatgtgtcgcgcccgctggttgctcccggcatcgcg
ctggtcttcatcgccctcgccggtgttggcgctgcggtgttcctcggctcggcgccgtcg
aacttcgtggtgatcgcggctgcggcctttggcgcctatatggcgctgaacattggtgcc
aatgacgtggccaacaacatgggtcctgcggtgggtgccaatgcgctgaccatgggtggg
gccattgtgatcgctgcgctcgccgaaagcgccggtgcgctgctggccggcggcgatgtg
gtctcgaccatttccaagggcattattgaccctgcgggcgttgccagctccgaagtgttc
atctgggccatgatggcggcgctgatttcctcagcgctgtgggtcaacctcgcgacctgg
atcggcgcgccggtctcaaccacccattcggttgtcggcggcgtcatgggcgcaggcatt
gctgcggccgggtttggagctgtgaactggcccaccatgagcaagatcgctgccagctgg
gtgatctcacccgtattgggcggcgtgattgcggcgctgttcctggcctttatcaaggcc
aagatcatttatcaggacgacaaaatcgctgccgcgcgccgctgggtgccggtgctggtg
ggcatcatggcgggggcgtttgcctcctatctggcgctgaagggcctgaagcggatcatc
aagattgatctggaaattgcgctgctgatcggtgccgcggttggcgggctgtcctatgtg
gtgaccgcgccgctgatcaagcgtcagtccgagggcatggagaaccgcaacaaatctctg
aaggtgctgttttcaatcccgctggtgatttctgccgcgctcttgtcctttgcccatggt
gccaatgatgtggccaatgcggtgggtccgctggcagcgattgtgcacaccaccgagttt
ggcgatatcgcgtccaaagtggcgatcccgacctgggtcatggtgatcggcgcctttggc
atctcctttggtctgttcctgttcggccccaagctgatccgcatggtcggcagccagatc
accaaattgaacccgatgcgcgcctattgtgtgtcgctgtcggcggcgatcaccgtgatt
gtggccagctggctggggctgccggtatcctccacccacatcgcggtgggggctgtgttt
ggcgtgggtttcttccgtgaatggcatatggaacgccgtctgaagcgcagttccgccacg
cgacctgaaaccaagcggattgcaccggaagagcgccgtcgtcgcaagttggtgcgtcgc
agccacttcatgaccattgctgccgcctgggtgatcaccgtgccggccgccgccctgctg
tcgggctgtgtcttcctggcgctgaccgcgatcaccatgtga

DBGET integrated database retrieval system