KEGG   Phaeobacter piscinae: PhaeoP14_03794Help
Entry
PhaeoP14_03794    CDS       T05105                                 

Gene name
gcvT
Definition
(GenBank) aminomethyltransferase GcvT
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
ppic  Phaeobacter piscinae
Pathway
ppic00260  Glycine, serine and threonine metabolism
ppic00630  Glyoxylate and dicarboxylate metabolism
ppic00670  One carbon pool by folate
ppic01100  Metabolic pathways
ppic01110  Biosynthesis of secondary metabolites
ppic01130  Biosynthesis of antibiotics
ppic01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PhaeoP14_03794 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PhaeoP14_03794 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PhaeoP14_03794 (gcvT)
Enzymes [BR:ppic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     PhaeoP14_03794 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: ATG41826
UniProt: A0A291G6X5
Position
pP14_c:complement(33057..34154)
Genome map
AA seq 365 aa AA seqDB search
MTDAPKRTPLYDLHVALGGKMVDFAGWEMPVQYPMGIMGEHKQCREKAALFDVSHMGQVI
LRGDNVGEKLEAICPQAYATLKEGKARYGFFTNEDGGIMDDLIVSNAGDHYFVVVNAALR
HQDIPHMKAHLDGVEVTEIFDRALVAVQGPAAENVVGDLCPAAREMKFMETIVADIDGVE
CRLSRLGYTGEDGYEISIPDADAERITKLFLAHEDCEPAGLGARDSLRLEAGLCLYGNDI
DQSTSPIEASLAWAIQKRRKEEGGFPGADRIQKELAEGAAKKLVGIKPSGRAPARQHVEI
QCAEGNTIGEITSGCFGPTVGGPVAMGYVAAPHGKVGEQVKLIIRGKAHDAEIVALPFVT
QNYKR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcgccgaaacgtactccgctctatgacctgcatgtcgccctcggcggcaag
atggtcgactttgccggctgggaaatgccggtccaataccccatgggcatcatgggagag
cacaagcagtgccgcgagaaagctgcgctgttcgatgtcagccacatgggtcaggtgatc
ctgcgcggcgacaacgtcggcgagaaactggaagcgatctgcccgcaggcctatgccacc
ctcaaggaaggcaaggcgcgctatggtttcttcaccaatgaagacggcggcatcatggat
gacctcatcgtctccaacgccggcgaccattatttcgtggtggtgaacgcggccctgcgt
catcaggacatcccccacatgaaggcgcatctcgacggcgtcgaagtgaccgagatcttc
gaccgcgcgctggtggccgttcagggccccgccgccgaaaatgtagtgggcgatctgtgc
cctgctgcccgtgagatgaagttcatggaaaccatcgtcgctgatatcgacggtgtggaa
tgtcggctgtcgcgcctcggctacactggcgaagatggctatgagatttccatccccgat
gcagacgccgaacgcatcaccaaactgttcctggcccatgaggattgtgagccggccggt
ctgggcgcgcgggactccctgcgtctggaagcgggcctctgcctctatggcaacgatatt
gaccagtcgacctctccgattgaggcgtcgctggcctgggcgatccagaaacgccgcaag
gaagagggcggtttccccggtgctgaccgcatccagaaagagctggccgaaggcgcggcg
aagaaactggtcgggatcaaaccctccgggcgcgcccctgcccgtcagcacgttgagatc
caatgcgccgaaggcaacaccattggtgagatcacctctggctgttttggccccaccgtc
ggcggcccggtcgccatgggctatgtcgcggccccgcacggcaaggtcggcgaacaggtc
aaactgatcattcgtggcaaggcccatgacgcagaaatcgtcgccctgcccttcgtcacc
cagaattacaaacgctaa

DBGET integrated database retrieval system