KEGG   Pseudoalteromonas piscicida: B1L02_09220Help
Entry
B1L02_09220       CDS       T04942                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppis  Pseudoalteromonas piscicida
Pathway
ppis00071  Fatty acid degradation
ppis00072  Synthesis and degradation of ketone bodies
ppis00280  Valine, leucine and isoleucine degradation
ppis00310  Lysine degradation
ppis00362  Benzoate degradation
ppis00380  Tryptophan metabolism
ppis00620  Pyruvate metabolism
ppis00630  Glyoxylate and dicarboxylate metabolism
ppis00640  Propanoate metabolism
ppis00650  Butanoate metabolism
ppis00900  Terpenoid backbone biosynthesis
ppis01100  Metabolic pathways
ppis01110  Biosynthesis of secondary metabolites
ppis01120  Microbial metabolism in diverse environments
ppis01130  Biosynthesis of antibiotics
ppis01200  Carbon metabolism
ppis01212  Fatty acid metabolism
ppis02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B1L02_09220
   00630 Glyoxylate and dicarboxylate metabolism
    B1L02_09220
   00640 Propanoate metabolism
    B1L02_09220
   00650 Butanoate metabolism
    B1L02_09220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B1L02_09220
   00072 Synthesis and degradation of ketone bodies
    B1L02_09220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B1L02_09220
   00310 Lysine degradation
    B1L02_09220
   00380 Tryptophan metabolism
    B1L02_09220
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B1L02_09220
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B1L02_09220
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B1L02_09220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppis04147]
    B1L02_09220
Enzymes [BR:ppis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B1L02_09220
Exosome [BR:ppis04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B1L02_09220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASD67188
UniProt: A0A0F4NQI6
Position
1:complement(1953795..1954973)
Genome map
AA seq 392 aa AA seqDB search
MSNEAVVIVAAKRTPMGGFMGSLSDATATDLGATAIKAVMNETGLSDASIDEVIMGCVLP
AGLGQAPARQAMLHAGLARSTGATTINKVCGSGLKAAMFAHDLIRSGSINSAIAGGMESM
TNSPYFIPKARGGMRMGHGEIKDHMMADGLEDAYDNKAMGCFAQATADEYGITREHMDEF
ALGSLSKANAAIENGSFGNEIAPHVMSTRKGDVEVNTDEQPGNARPDKIPSLRPAFKKDG
TITAANSSSISDGAAALILMSESEAKKHGLTPLCKIVAHATHSQAPAEFTVAPVGAMNKL
LEKSGWSTADVDLWEINEAFAMVTMLAINEMQLDSNKVNVNGGACALGHPIGASGARILV
TLIHALKNRGLSKGVASLCIGGGEAVALAVEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgaagctgttgtcatcgtcgctgctaagcgtacaccaatgggtggctttatg
ggaagcctatctgacgcaaccgcgacagacttaggtgcgactgcaattaaagcagtaatg
aatgaaacaggtcttagtgacgcgagtatagacgaagttattatgggttgcgtactaccc
gcaggtctcggtcaagcgccagcgcgtcaagcgatgctacatgcagggttagcacgttca
actggtgcgacaacaatcaataaagtatgtggctcgggtctaaaagcggcgatgttcgcg
catgatctcatccgctcaggtagcattaattctgctatcgctggtggcatggaaagcatg
actaactcaccttactttattccaaaagcccgtggcggaatgcgtatgggtcatggcgaa
atcaaagaccatatgatggctgatggcttagaagatgcttatgataataaagcgatgggt
tgtttcgcacaagctaccgctgatgaatatggcataacccgtgagcacatggatgaattt
gcacttggctctctaagtaaagcaaacgccgcaatcgaaaatggcagttttggcaatgag
attgctcctcatgtaatgagtacacgtaagggggatgttgaggtaaataccgacgagcaa
cctggtaatgcccgtccagacaaaattccatcacttcgcccagcatttaaaaaagatggc
actatcactgctgccaactcttcgtctatttcagacggtgcagccgcgctgattttaatg
agtgaatcagaagcgaaaaagcacggtttgacgccactttgtaagattgttgcccatgca
actcactcacaagcgcctgctgaatttaccgttgcgccggtcggtgcgatgaataagctg
cttgaaaaatcaggttggtcgacagcagacgttgatctttgggaaatcaacgaagcattt
gccatggtgactatgttggctatcaacgaaatgcagttagatagcaacaaagtcaacgta
aacggtggtgcttgtgcgcttggtcacccaatcggtgcaagcggtgcacgtatcttagtt
acacttatccatgcactaaaaaaccgcggcttatcaaaaggcgtagcctcactatgtatc
ggtggtggtgaagctgtagcgcttgcggtagaagtgtaa

DBGET integrated database retrieval system