KEGG   Pseudoalteromonas piscicida: B1L02_13845Help
Entry
B1L02_13845       CDS       T04942                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
ppis  Pseudoalteromonas piscicida
Pathway
ppis00270  Cysteine and methionine metabolism
ppis00480  Glutathione metabolism
ppis01100  Metabolic pathways
Module
ppis_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:ppis00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    B1L02_13845
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B1L02_13845
Enzymes [BR:ppis01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     B1L02_13845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ASD67980
UniProt: A0A3B6Y4Q1
Position
1:2975978..2976937
Genome map
AA seq 319 aa AA seqDB search
MTIKLGIISDPISGFNIKKDTGFAMMLAAQQRGYELYYMEMNDLFLYQGVAKATAAKTQV
FDDTSHWYELAEKQEINLGDLDVILMRKDPPFDTEYIYATYILERAELAGSLVVNKPQSL
RDANEKLFTAWFSEHTPDTLVTRNQSQIREFLAKHGDIILKPLDGMGGASIFRVKQNDAN
IGVICETLTEHGSRYAMAQNYIPAIKDGDKRVLVVDGEVMPYCLARIPQGGETRGNLAAG
GRGEARPISESDRKVAEAIAPTLKAKGLIFVGLDIIGDKLTEINVTAPTCVKEIEAAYDI
SIMDKFYDAIERKLDHTKS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacgattaaattagggatcatttccgatccaatcagtggctttaacattaaaaaagac
accgggtttgccatgatgctggcggcacagcagcgcggctatgaattgtattacatggaa
atgaatgacctgttcttgtaccaaggcgttgccaaagcgaccgcggcaaaaacgcaagtg
tttgacgatacctcccattggtatgaactggctgagaaacaagaaatcaacttaggcgac
cttgacgttattttaatgcgtaaagacccgccttttgacactgaatatatttacgccact
tatattctcgagcgcgctgagcttgcagggtcgcttgtggtaaataaaccacaaagcctg
cgtgacgccaatgaaaagctctttactgcgtggtttagcgaacatactccagatactttg
gttacacgtaatcaatcacaaattcgcgagtttttagctaaacatggcgatatcattctc
aagcctctagatggaatgggtggcgcgtctatctttagagtgaaacaaaatgatgcaaat
attggggtgatctgcgaaacgcttactgagcatggttctcgctatgctatggcgcaaaac
tatatcccagcaattaaagacggtgataagcgcgtattagtggtagacggtgaagtgatg
ccgtactgcttagctcgcattccacaaggcggtgaaactcgtggtaatctcgcggcgggc
ggccgtggtgaagcaagaccaattagcgagtcggaccgtaaagtcgccgaagctattgcc
ccaacgttaaaagcaaagggcctgatattcgttggcctagatatcattggcgataagctc
accgaaatcaatgtcaccgcaccaacctgcgtgaaagaaattgaagcagcgtatgacatt
tcaattatggataagttttatgatgcgatcgagcgaaaactcgaccatactaaaagctaa

DBGET integrated database retrieval system