KEGG   Pseudomonas plecoglossicida: RK21_00598Help
Entry
RK21_00598        CDS       T03646                                 

Definition
(GenBank) acyl coenzyme A synthetase 1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ppj  Pseudomonas plecoglossicida
Pathway
ppj00061  Fatty acid biosynthesis
ppj00071  Fatty acid degradation
ppj01100  Metabolic pathways
ppj01212  Fatty acid metabolism
ppj02024  Quorum sensing
Module
ppj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RK21_00598
   00071 Fatty acid degradation
    RK21_00598
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RK21_00598
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppj01004]
    RK21_00598
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppj04147]
    RK21_00598
Enzymes [BR:ppj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     RK21_00598
Lipid biosynthesis proteins [BR:ppj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   RK21_00598
Exosome [BR:ppj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   RK21_00598
  Exosomal proteins of breast cancer cells
   RK21_00598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2 DUF599 DUF3710
Motif
Other DBs
NCBI-ProteinID: AJG12106
UniProt: A0A0B5K954
Position
658765..660462
Genome map
AA seq 565 aa AA seqDB search
MIENFWKDKYPAGITAEINPDEFPNIQAVLKQSCQRFADKPAFSNLGKTITYGELYALSG
AFAAWLQQHTDLKPGDRIAVQLPNVLQYPVAVFGAMRAGLIVVNTNPLYTAREMEHQFND
SGAKALVCLANMAHLAEKVVPKTQVRHVIVTEVADLLPPLKRLLINSVIKYVKKMVPAYN
LPRAVRFNDALAQGKGQPVTEANPQANDVAVLQYTGGTTGVAKGAMLTHRNLVANMLQCR
ALMGSNLHEGCEILITPLPLYHIYAFTFHCMAMMLIGNHNVLISNPRDLPAMVKELGKWK
FSGFVGLNTLFVALCNNEAFRALDFSALKITLSGGMALQLSVAERWKAVTGCAICEGYGM
TETSPVAAVNPAEANQVGTIGIPVPSTLCKVIDDNGNELPLGEVGELCVKGPQVMKGYWQ
REEATAEILDSDGWLKTGDIAVIQPDGYMRIVDRKKDMILVSGFNVYPNELEDVLAALPG
VLQCAAIGVPDEKSGEVIKVFIVVKPGMTLTKEQVMEHMRANVTGYKVPRQIEFRDALPT
TNVGKILRRELRDEELKKQGLKKIA
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaaatttttggaaggataagtacccagccgggattacggcggaaatcaatcct
gacgaattccccaatatccaggcggtactcaagcaatcctgccaacgctttgccgacaaa
ccggcctttagcaacctgggcaagactatcacttatggcgagctgtatgcgctgtcggga
gcgtttgccgcctggttgcagcagcataccgacctcaagccgggtgaccgcattgccgtg
cagctgcctaacgtactgcaatacccggtagcggtattcggtgccatgcgtgccgggctg
atcgtggtcaacaccaacccgctgtacaccgcacgggaaatggaacaccagttcaacgac
tccggcgccaaggccttggtgtgcctggccaacatggcccacctggccgagaaggtagtg
cccaagacccaggtcaggcacgtcatcgtcaccgaagtggccgacctgctgccgccgctc
aagcgcctgctgatcaacagcgtgatcaagtacgtgaagaagatggtgccggcctacaac
ctgccgcgtgccgtacgcttcaacgacgctctggcgcagggcaagggccagccggtgacc
gaggccaacccgcaggccaacgacgtggcggtgctgcagtacaccggtggcaccaccggc
gtggccaagggcgcgatgcttacccaccgcaaccttgtggccaacatgctgcagtgccgg
gcgctgatgggctccaacctgcatgaaggctgcgaaatcctcatcaccccgctgccgctg
taccacatctacgcctttaccttccattgcatggcaatgatgctgatcggcaaccacaac
gtgctgatcagcaacccgcgtgacctgccagccatggtcaaggaactgggcaagtggaag
ttcagcggcttcgtcggcctcaacaccctgttcgttgccttgtgcaacaacgaggcgttc
cgtgccctggacttttcggcgctgaagatcaccctttctggcggcatggccctgcaactg
agcgtggccgagcgctggaaggccgtgaccggctgcgccatctgcgaaggctatggcatg
accgagaccagcccggtggctgcggtgaacccggctgaggccaaccaggtcggcaccatc
ggtattccggtgccgtccaccctgtgcaaggtcatcgacgacaacggcaacgagctgccg
ctgggcgaggtgggcgagttgtgcgtcaagggcccgcaggtgatgaagggctactggcag
cgtgaggaggccactgccgagatcctcgacagcgatggctggctgaagaccggcgacatc
gccgtgatccagccggatggttacatgcgcatcgtcgaccgcaagaaggacatgatcctg
gtctcgggcttcaacgtttaccccaacgagctggaggatgtgctggcggccctgccgggc
gtgcttcagtgcgcggccatcggcgtgccggacgagaagtccggtgaagtgatcaaggtg
ttcatcgtggtcaagccgggcatgaccctgaccaaggaacaggtaatggagcacatgcgc
gccaacgttaccggctacaaggtaccgcgccagatcgagttccgcgacgcgctgccgacc
accaacgtgggcaagatcctgcgccgtgagctgcgtgatgaagagctgaagaagcagggc
ctgaagaagatcgcctga

DBGET integrated database retrieval system