KEGG   Pseudomonas plecoglossicida: RK21_01808Help
Entry
RK21_01808        CDS       T03646                                 

Definition
(GenBank) gluconate 2-dehydrogenase
  KO
K00032  phosphogluconate 2-dehydrogenase [EC:1.1.1.43]
Organism
ppj  Pseudomonas plecoglossicida
Pathway
ppj00030  Pentose phosphate pathway
ppj00480  Glutathione metabolism
ppj01100  Metabolic pathways
ppj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RK21_01808
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RK21_01808
Enzymes [BR:ppj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.43  phosphogluconate 2-dehydrogenase
     RK21_01808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored IlvN XdhC_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AJG13316
UniProt: A0A099MZV7
Position
1940649..1941611
Genome map
AA seq 320 aa AA seqDB search
MKKRIVLYKRLSDDLMARLQERVEVTWVDTSQPDGLARLRDALPGAHGLLGASLRLDASL
LDLAPQLEVVSSVSVGVDNYDIAELSRRGVMLTNTPDVLTETTADTGFALILATARRVVE
LANWVRDGSWQANLGPAHFGSDVHGKTLGIVGMGRIGEALARRAAAGFGMRVLYHSQRAK
PEVEARHAARQCSLDELLQQADFVCLTVPLSASTEGLIGARELALMKPQAILVNISRGRV
VDEPALIEALRARRIRGAGLDVFVQEPLPAQSPLLQLDNVVATPHIGSATEETRQAMARC
AVDNLLSALAGERPANLVNG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcgaatcgtcctgtacaaacgcctgtccgacgacttgatggcacgcctgcaa
gagcgcgtcgaggtgacctgggtggatacctcccagcccgatggcctggcccgtctgcgc
gatgccttgccgggggcgcacgggctgctgggggccagcctgcgcctggatgccagcctg
ctcgacctggcgccacagcttgaagtggtgtccagcgtttcggtcggtgtcgacaactac
gacatcgccgaactcagccggcgtggcgtgatgttgaccaacactcccgacgtgctgacc
gaaaccaccgccgacacgggcttcgccttgatcctggccaccgccaggcgggtggtggag
ctggcgaactgggtgcgagacgggagctggcaggccaacctcggcccggcgcatttcggc
agtgatgtgcacggtaagacgctgggcatcgtcggcatgggccgcatcggcgaggccctg
gcccggcgcgccgcggccggctttggcatgcgtgtgctgtatcacagtcagcgtgcaaag
ccagaggtggaggcgcgccatgctgcgcgtcaatgcagcctggacgagctgttgcagcag
gcggatttcgtttgcctgaccgtgccgctgagtgccagcaccgaaggcctgatcggcgcg
cgggagctggcgctgatgaagccccaggcaattctggtgaacatttcccgcgggcgcgtg
gtggatgagccagcgcttatcgaagcgttgcgtgcccggcgcatacgcggcgccggcctg
gatgtgttcgtgcaggagccgttgccggcgcagtcgccgttgttgcagctggacaacgtg
gtggcgaccccgcatatcggctcggcgaccgaggaaacccgccaggccatggcgcgctgt
gcggtggacaacctgctcagtgccctggctggtgagcgcccggccaacctggtgaatggc
taa

DBGET integrated database retrieval system