KEGG   Pseudomonas plecoglossicida: RK21_02902Help
Entry
RK21_02902        CDS       T03646                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppj  Pseudomonas plecoglossicida
Pathway
ppj00071  Fatty acid degradation
ppj00072  Synthesis and degradation of ketone bodies
ppj00280  Valine, leucine and isoleucine degradation
ppj00310  Lysine degradation
ppj00362  Benzoate degradation
ppj00380  Tryptophan metabolism
ppj00620  Pyruvate metabolism
ppj00630  Glyoxylate and dicarboxylate metabolism
ppj00640  Propanoate metabolism
ppj00650  Butanoate metabolism
ppj00900  Terpenoid backbone biosynthesis
ppj01100  Metabolic pathways
ppj01110  Biosynthesis of secondary metabolites
ppj01120  Microbial metabolism in diverse environments
ppj01130  Biosynthesis of antibiotics
ppj01200  Carbon metabolism
ppj01212  Fatty acid metabolism
ppj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RK21_02902
   00630 Glyoxylate and dicarboxylate metabolism
    RK21_02902
   00640 Propanoate metabolism
    RK21_02902
   00650 Butanoate metabolism
    RK21_02902
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RK21_02902
   00072 Synthesis and degradation of ketone bodies
    RK21_02902
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RK21_02902
   00310 Lysine degradation
    RK21_02902
   00380 Tryptophan metabolism
    RK21_02902
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RK21_02902
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RK21_02902
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RK21_02902
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppj04147]
    RK21_02902
Enzymes [BR:ppj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RK21_02902
Exosome [BR:ppj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RK21_02902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJG14410
UniProt: A0A0B5KDB9
Position
complement(3050724..3051926)
Genome map
AA seq 400 aa AA seqDB search
MLDAYIFAGLRTPFGRHGGALASVRPDDLAAHVIHELLARHAIPGEAIEDVILGNTNQAG
EDSRNIARHAALLAGLPVTVPGQTVNRLCASGLAAVIDAARAVTCNEGELFVAGGVESMS
RAPFVMAKAEAAYSRELTVFDSTIGARFPNPKIVAEFGNDSMPQTGDNVAQEYGISRAEA
DVFAAGSQARYEAARSAGFFQEELLAVSVPTGRKTPPNVVEQDEHPRPQSDLIALARLNP
LSEGGVVTAGNASGVNDGAAALLIGSAAAGERHGLVPMARILSAAAVGVAPRIMGVGPVE
AIHKALARAQLSLADMDIIEINEAFASQVLGCLKGLGVAFNDPRVNPHGGAIAVGHPLGA
SGARLALSTARALQQSGKRYAVVSLCIGVGQGLAMVMERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcctacatcttcgcgggactgcgcacgccatttggccgccacggcggcgca
ctcgcttcggtacgcccagacgacctcgccgcccatgtgatccacgaattgctcgctcgc
cacgccatccctggcgaagccatcgaggacgtgattctgggcaataccaaccaggcaggg
gaggacagccgcaacatcgcgcgtcacgccgcactgcttgcaggcttgcccgtgaccgta
cctgggcagacagttaaccgcctgtgcgccagtggtctggcggcggtgatcgatgccgcc
cgcgcagtgacctgtaacgaaggcgaactgtttgtcgccggcggggtggagagtatgtcc
cgtgcaccctttgtcatggctaaagcagaagcggcctatagccgcgaactgacggtgttc
gacagtaccattggcgcccgttttcccaacccgaagatcgtcgccgagtttggcaacgac
agcatgccgcaaacgggcgataacgtggctcaggagtacggcatctcccgtgctgaggcc
gacgtctttgctgccggctctcaggcccgttatgaagccgcacgtagcgcaggtttcttt
caggaagaactgctcgcggtcagcgtgcccaccgggcgcaagacgccacccaatgtggtg
gagcaggacgagcacccgcgcccgcaatcggacctgatcgctttggctcgcctgaatcct
ctctccgaaggtggtgtggttaccgccggcaacgcatcaggcgtcaacgatggcgcggcg
gcattgctgattggctcggccgcggcgggcgaacggcacggcttggttccgatggcgcgc
attctgtcggccgccgccgtgggtgtggccccgcgcattatgggcgtcggcccggtggag
gctattcataaggcattggctcgcgcgcagctcagcctggcggatatggacattatcgag
atcaacgaagcgttcgccagccaggtgctgggctgcctgaaaggtctgggtgttgcgttc
aacgacccgcgggtaaacccacacggtggcgccatcgccgtcggccacccattaggtgca
tccggtgcgcgcctggccctgagcaccgctcgcgcgctgcaacagagcggcaaacgctac
gctgtggtgagcctatgcatcggcgtgggccaaggcctcgccatggtgatggagcgtgtg
taa

DBGET integrated database retrieval system