KEGG   Pseudomonas plecoglossicida: RK21_04037Help
Entry
RK21_04037        CDS       T03646                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase, C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
ppj  Pseudomonas plecoglossicida
Pathway
ppj00970  Aminoacyl-tRNA biosynthesis
ppj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RK21_04037
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ppj03029]
    RK21_04037
Enzymes [BR:ppj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RK21_04037
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RK21_04037
Mitochondrial biogenesis [BR:ppj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RK21_04037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AJG15545
UniProt: A0A099MTY3
Position
4235173..4235460
Genome map
AA seq 95 aa AA seqDB search
MALERCDVEKIAHLARLGLNDGELPRITDALNSILGLVDQMQAVDTTGIEPLAHPLEASQ
RLRPDQVTESNQRDAYQAIAPSTESGLYLVPKVIE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgaacgctgcgacgtggaaaagatcgcccatctggcccgtctggggctgaat
gatggcgaactgccacgcattactgacgcactgaacagcattctcgggctggtcgaccag
atgcaagcggtcgacactactggcatcgagccactggcccaccccctggaggccagccag
cgcctgcgtcccgaccaggtcaccgagagcaaccagcgcgacgcctaccaggccatcgcg
ccgtcgaccgaaagcggtctgtacctggttcccaaagtcatcgagtaa

DBGET integrated database retrieval system