KEGG   Pseudomonas plecoglossicida: RK21_04198Help
Entry
RK21_04198        CDS       T03646                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ppj  Pseudomonas plecoglossicida
Pathway
ppj00020  Citrate cycle (TCA cycle)
ppj00620  Pyruvate metabolism
ppj01100  Metabolic pathways
ppj01110  Biosynthesis of secondary metabolites
ppj01120  Microbial metabolism in diverse environments
ppj01130  Biosynthesis of antibiotics
ppj01200  Carbon metabolism
Module
ppj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RK21_04198
   00620 Pyruvate metabolism
    RK21_04198
Enzymes [BR:ppj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     RK21_04198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AJG15706
UniProt: A0A0B5KJ50
Position
4396940..4398448
Genome map
AA seq 502 aa AA seqDB search
MAQNESVDVVLVGAGIMSATLAVLLKELDPTLKLEVVEAMDSGAAESSNPWNNAGTGHAG
LCELNYTPQAADGSIDIKKAVHINTQFEVSRQFWAYLSKKGNFGSARAFINPVPHLSYVE
GDKGVSFLKKRYELLKQHHAFADMEYTEDKAVMKDWMPLMMPGRPADQHIAATRVLKGTD
VNFGALTNKLLKLLGDSQDAQVKYSKKVVGLRRNGKGWTVSIKDVNSGGSREVDARFVFL
GAGGAALPLLQLSGIPESKGFGGFPVSGQWLRCDNPEIVKQHQAKVYSQAAVGAPPMSVP
HLDTRVVDGKKSLLFGPYAGFTTKFLKHGSLMDLPLSVRMGNIGPMLAVARDNMDLTKYL
VSEVMQSMEQRLEALRRFYPQAKAEDWRLEVAGQRVQIIKKDPKKGGVLQFGTELVSAQD
GSLAALLGASPGASVTVSIMLELIERCFPEQAKGAWAAKLKEIFPAREKILATDAALYHK
ISADNDVALDLVESSPAAKHYA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaacgaatcggttgatgtggtactggtaggcgcaggcatcatgagtgccacc
ctggccgtactgctcaaggagctcgacccgaccctgaagcttgaggtcgtggaggcgatg
gactccggagccgcggaaagctccaacccctggaacaacgcaggcaccggccacgccggc
ctgtgcgagcttaactacacgccccaggccgccgatggcagcatcgacatcaagaaggcc
gtgcacatcaacacccagttcgaggtttcgcgccagttctgggcctacctgagcaagaag
ggcaacttcggctcggcacgtgccttcatcaaccctgtcccgcacctgagctacgtcgag
ggtgacaagggtgtttccttcctcaagaagcgctatgagctgctcaagcagcaccatgcc
tttgcggacatggaatacaccgaagacaaggccgtgatgaaggactggatgccgctgatg
atgccaggccgcccagccgaccagcacatcgccgccacccgcgtgctcaagggcaccgac
gtcaacttcggcgccctgaccaacaagctgctgaagctgctgggcgactcgcaggacgcc
caggtcaagtacagcaagaaggtcgttggcctgcgccgtaacggcaagggctggaccgtg
agcatcaaggacgtcaacagcggcggtagccgtgaagtggacgcccgcttcgtcttcctc
ggcgccggtggcgcggccctgccgctgctgcagctgtcgggcattccggaaagcaaaggt
ttcggcggcttcccggtcagcggccagtggctgcgttgcgacaacccggaaatcgtcaag
cagcaccaggccaaggtctacagccaggccgcggtcggcgccccgccgatgtcggtaccg
cacctggatacccgcgtggtcgatggcaagaaatcgctgctgttcggtccatatgccggc
ttcaccaccaagttcctgaagcacggttcgctgatggacctgccgctgtcggtacgcatg
ggcaacatcggcccgatgctggccgtggcccgtgacaacatggacctgaccaagtacctg
gtcagcgaagtgatgcagtcgatggagcagcgcctggaagccctgcgtcgcttctacccg
caggccaaggccgaagactggcgcctggaagtagccggtcagcgcgtgcagatcatcaag
aaagacccgaaaaaaggcggcgtgctgcagttcggtaccgagctggtctcagcccaggac
ggcagcctggctgcactgctcggcgcatcgccgggcgcttcggtgaccgtttcgatcatg
ctggaactgatcgagcgctgcttccccgagcaggccaaaggtgcctgggctgccaagctc
aaggaaatcttcccggctcgcgagaagatcctggcgaccgatgctgccctgtaccacaag
atcagtgccgacaacgacgtggcgctggacctggtggaaagcagcccggcggccaagcat
tacgcctga

DBGET integrated database retrieval system