KEGG   Pseudomonas plecoglossicida: RK21_05244Help
Entry
RK21_05244        CDS       T03646                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
ppj  Pseudomonas plecoglossicida
Pathway
ppj00020  Citrate cycle (TCA cycle)
ppj00620  Pyruvate metabolism
ppj00650  Butanoate metabolism
ppj01100  Metabolic pathways
ppj01110  Biosynthesis of secondary metabolites
ppj01120  Microbial metabolism in diverse environments
ppj01130  Biosynthesis of antibiotics
ppj01200  Carbon metabolism
Module
ppj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RK21_05244
   00620 Pyruvate metabolism
    RK21_05244
   00650 Butanoate metabolism
    RK21_05244
Enzymes [BR:ppj01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     RK21_05244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom
Motif
Other DBs
NCBI-ProteinID: AJG16752
UniProt: A0A099N9D0
Position
complement(5493166..5494659)
Genome map
AA seq 497 aa AA seqDB search
MYRDRIRLSSLHSKVMSAADAAGLIEDGMTVGMSGFTRAGEAKAVPHALAERAKQSPLKI
SLMTGASLGNDLDKQLTEAGVLARRMPFQVDSTLRKAINDGQVMFIDQHLSETVEQLRNQ
QLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFAKQVIVEINLSHNTNLEGLHDIYI
PTYRPTRTPIPLVKVDDRIGSTAIPIDPAKIVGIVISDQPDSPSTVLPPDDETQGIADHL
INFFKKEVEAGRMTNKLGPLQAGIGSIANAVMCGLIESPFEDLTMYSEVLQDSTFDLIDA
GKLSFASGSSITLSTRRNADVFGNLERYKDKLVLRPQEISNHPEVVRRLGIIGINTALEF
DIYGNVNSTHVCGTKMMNGIGGSGDFARNAHLAVFVTKSIAKGGAISSVVPMVSHVDHTE
HDVDILVTEQGLADLRGLAPRERARAIIDNCVHPDYRAALNDYFDRACQRGGHTPHILRE
ALSWHENLEETGRMLAS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtgatcgtatccgcttgtcctccctgcacagcaaggtaatgagtgcggctgat
gccgctggtctgatcgaggacggcatgaccgtcggcatgagcggtttcacccgcgccggc
gaagccaaggccgtaccacatgcactggccgaacgtgccaagcagtcgccactgaaaatc
agcctgatgaccggcgccagcctgggcaacgacctggacaagcaactgaccgaggccggc
gtgctggctcgccgcatgccgttccaggtcgacagcaccctgcgcaaggccatcaacgac
ggccaagtgatgttcatcgaccagcacctgtcggaaaccgtcgagcaactgcgcaaccag
cagttgaagctgccggacatcgcggtcatcgaagccgtggccatcaccgagcagggccac
atcgtgccaaccacctcggtgggcaactccgccagcttcgcgatcttcgccaagcaggtg
attgtcgagatcaacctctcgcacaacaccaacctcgaaggcctgcacgacatctatatc
ccgacctaccgcccgacccgcacgccaatcccgctggtcaaggtcgacgaccgtatcggc
agcaccgccatcccgatcgacccggccaagatcgtcggcatcgtcatcagcgaccagccg
gactcgccgtccaccgtactgcctccggatgacgaaacccagggcatcgccgaccacctg
atcaacttcttcaagaaagaagtcgaggccggccgcatgaccaacaagctcggcccgctg
caggccggtatcggcagcattgccaacgcagtgatgtgcggcctgatcgagtcgccgttc
gaagacctgaccatgtactccgaagtactgcaggactccaccttcgacctgatcgacgcc
ggcaagctgagcttcgcctcgggcagctcgatcaccttgtcgacccgccgcaacgccgac
gtgttcggcaacctggagcgttacaaggacaagctggtactgcgcccgcaagaaatctcc
aaccacccggaggtggtccgtcgcctgggcatcatcggtatcaacaccgcgcttgagttc
gatatctacggcaacgtcaattccacacacgtgtgcggtaccaagatgatgaacggcatc
ggcggctcgggtgacttcgcccgtaacgcccatctggccgtgttcgtcaccaagtcgatt
gccaagggtggggcgatttccagcgtggtgccgatggtcagccatgtcgaccataccgag
cacgatgtggacatcctggtcaccgagcaaggcttggccgacctgcgcggcctggcgcca
cgcgagcgcgccagggcgatcatcgacaactgtgtgcacccggactaccgcgcagcactg
aacgactacttcgatcgcgcctgccagcgtggcggccataccccgcacatcctgcgtgaa
gccctgagttggcacgagaacctggaagaaaccgggcgcatgctggctagctga

DBGET integrated database retrieval system