KEGG   Pandoraea pnomenusa 3kgm: U875_10060Help
Entry
U875_10060        CDS       T02936                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppk  Pandoraea pnomenusa 3kgm
Pathway
ppk00071  Fatty acid degradation
ppk00072  Synthesis and degradation of ketone bodies
ppk00280  Valine, leucine and isoleucine degradation
ppk00310  Lysine degradation
ppk00362  Benzoate degradation
ppk00380  Tryptophan metabolism
ppk00620  Pyruvate metabolism
ppk00630  Glyoxylate and dicarboxylate metabolism
ppk00640  Propanoate metabolism
ppk00650  Butanoate metabolism
ppk00900  Terpenoid backbone biosynthesis
ppk01100  Metabolic pathways
ppk01110  Biosynthesis of secondary metabolites
ppk01120  Microbial metabolism in diverse environments
ppk01130  Biosynthesis of antibiotics
ppk01200  Carbon metabolism
ppk01212  Fatty acid metabolism
ppk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    U875_10060
   00630 Glyoxylate and dicarboxylate metabolism
    U875_10060
   00640 Propanoate metabolism
    U875_10060
   00650 Butanoate metabolism
    U875_10060
  09103 Lipid metabolism
   00071 Fatty acid degradation
    U875_10060
   00072 Synthesis and degradation of ketone bodies
    U875_10060
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    U875_10060
   00310 Lysine degradation
    U875_10060
   00380 Tryptophan metabolism
    U875_10060
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    U875_10060
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    U875_10060
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    U875_10060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppk04147]
    U875_10060
Enzymes [BR:ppk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     U875_10060
Exosome [BR:ppk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   U875_10060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: AHB05675
UniProt: V5PSK8
Position
2173787..2174968
Genome map
AA seq 393 aa AA seqDB search
MQREVVIVSGVRTAIGDFGGSLKDFAPTQLGAIVAREAMARAQVSGEDVGHVVFGNVIHT
EPKDMYLARVASIEAGVSQHAPAMTVNRLCGSGLQAVVSAAQSILLGDAEVAMAGGAESM
SRAPYVMQGARWGTRMGESRLVDMMLGALHDPFANIHMGVTAENIAKQWGITREDQDRLA
VESHQRAARAMAEGYFRDQIVPISIKTKKGEIAFTTDEHVRADVRLEDMAKLRPVFEKDG
TVTAGNASGLNDAAAALILMERAEAQRRGAKPLARLVSYAHAGVDPNYMGIGPVPASRKA
LERAGLQVGDIDVVEANEAFAAQACAVTRDLGFDPARVNPNGSGISLGHPIGATGALITV
KALHELQRIGGRYALVTMCIGGGQGIAAVFERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgagaagtcgtgatcgtcagcggagttcgtaccgcgatcggtgattttggtggc
agcctgaaggatttcgcgccgacgcagctcggtgcgatcgtcgcccgcgaagccatggcg
cgcgcgcaagtcagcggcgaagacgtcggacacgtggtgttcggcaacgtcattcatacc
gaacccaaggacatgtatctggcgcgcgtcgcctcgatcgaggctggcgtgagccagcac
gcgccggccatgacggtgaaccgcctgtgcggctcggggctacaggccgtggtctcggcc
gcgcagtcgatcctgctcggcgacgcggaagtggcaatggcgggtggcgcggagagcatg
agccgtgccccgtacgtgatgcagggcgcgcgctggggtacccgaatgggcgaatcgcgc
ctggtcgacatgatgctcggtgcactgcacgatccgttcgccaacattcacatgggcgtg
acggcggagaacatcgcgaagcagtggggcatcacgcgcgaggatcaggatcgtctcgcc
gtcgagtcgcaccagcgcgccgcgcgcgcgatggccgaggggtacttcagggatcagatc
gttcccatctcgatcaagacgaagaagggcgagatcgcgttcacgaccgacgagcacgtg
cgggccgacgtacgtctggaagacatggcgaagttgcgtcccgtgttcgagaaggacggc
accgtgacggcggggaatgcgtcgggcctgaacgatgccgcggccgcgctgatcctgatg
gagcgcgccgaagcgcagcgccgcggcgcgaagccgctggcgcgtctggtgagctatgcg
cacgcaggcgtggaccccaattacatgggcatcggtcccgtgccggcctcgcgcaaggcg
ctcgagcgtgccggactccaggtcggcgacatcgacgtggtggaggcgaacgaagccttc
gccgcccaggcctgcgcggtcacgcgcgatctcggcttcgatccggccagggtcaatccg
aacggctcgggcatttcgcttggccatccgatcggcgcgacgggggcactgattaccgtc
aaggcgctgcatgaactgcagcgcatcggtggccggtacgcgctggtgacgatgtgcatc
ggcggcggccagggcattgcggccgtgttcgagcgcgtgtaa

DBGET integrated database retrieval system