KEGG   Pandoraea pnomenusa 3kgm: U875_25645Help
Entry
U875_25645        CDS       T02936                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ppk  Pandoraea pnomenusa 3kgm
Pathway
ppk00260  Glycine, serine and threonine metabolism
ppk01100  Metabolic pathways
ppk01110  Biosynthesis of secondary metabolites
ppk01120  Microbial metabolism in diverse environments
ppk01130  Biosynthesis of antibiotics
ppk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    U875_25645
Enzymes [BR:ppk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     U875_25645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIM43946
Position
1719731..1720780
Genome map
AA seq 349 aa AA seqDB search
MATPQHFASDNYAGICPEALHYLIEANASGHEVAYGDDRWTQRVCDGIRQLFDTDCEVFF
VFNGTAANSLALASLSQSYHSVICHELAHVETDECGGPEFFSNGAKLLTARGRENNGKLT
PDAVESVINRRSDIHFPKPRVVTLTQATEVGTVYTVDEVKAIAAVAKRRNLRVHMDGARF
ANAVATLGCHPGDVTWRAGVDVLCFGGTKNGLPVGEAVVFFNRSLAEDFAYRVKQAGQLA
SKMRFISAPWLGMLENDTWLRNARHANAMAQHLAQRIHDVPGVSLMFETQANAVFAELPL
HVIEALRAKGWRFYTFIGAGGCRFMCAWDTRPETVERLAADIRELSTKT
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
attgcaacgccacaacatttcgcatcggacaattacgcgggtatctgtccggaggcgctg
cactatctgatcgaggccaacgccagcggccatgaagtcgcctatggcgacgaccgctgg
acacagcgtgtgtgcgacggcattcggcaactgttcgacaccgactgcgaggtcttcttc
gtgttcaacggtacggcggcgaattcgctggccctcgcgtcgctctcgcagtcgtatcac
tccgtgatctgtcacgaactggcacacgtcgagacggacgaatgtggcggccccgaattt
ttctccaacggcgccaagctgctcacggcgcgcggacgcgagaacaacggcaagcttacg
cccgacgccgtggaatccgtcatcaatcgccgctccgatatccacttcccgaagccccgg
gtggtgacccttacccaggccaccgaggtcggcacggtctatacggtcgatgaggtcaag
gcgatcgccgccgtggcaaagcgacgcaacctgcgagtgcacatggacggcgcgcgcttt
gccaacgccgtggccacgctgggctgccaccccggggatgtgacctggcgcgccggtgtc
gacgtcctgtgtttcggcggtaccaagaacggtctgccggtgggagaggccgtggtgttc
ttcaaccggtcgctggccgaggacttcgcctaccgggtgaagcaggccgggcaactggcg
tcgaagatgcgtttcatttccgccccgtggctcggcatgctggaaaacgacacctggctg
cgcaatgcgcgccatgccaatgcgatggcacaacacctggcgcagcggattcacgatgtg
ccgggcgtatcgctgatgttcgagacgcaggctaatgcagtgttcgcggagctgcctctg
cacgttatcgaagcgttgcgcgcgaaggggtggcgcttctatacgttcatcggcgcaggt
ggctgccgcttcatgtgcgcctgggacacgcgaccggagacggtcgaacgtctggcggcc
gatatccgggaactgagcacgaagacctga

DBGET integrated database retrieval system