KEGG   Postia placenta: POSPLDRAFT_100535Help
Entry
POSPLDRAFT_100535 CDS       T01162                                 

Definition
(GenBank) predicted protein
  KO
K13333  lysophospholipase [EC:3.1.1.5]
Organism
ppl  Postia placenta
Pathway
ppl00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    POSPLDRAFT_100535
Enzymes [BR:ppl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     POSPLDRAFT_100535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B Patatin
Motif
Other DBs
NCBI-ProteinID: EED83689
JGI: 100535
UniProt: B8P611
AA seq 626 aa AA seqDB search
MKHLALLLSAVLCCIPLPVASQLAASVAYAPVLTPCPSGVSLLREVGTVDQSLSDGEHAY
VAGRRSEVLPGAWGSYLAAVLKSMTGVTNLPEYVTDILGGTYGERGYPHFGIVTSGGGYR
AAIFGAGVLNTLDGRNTTSVEAGTGGLLQAATYLAGLSGGSWLVTSLAQANFPTLPDLIF
GPSASGKDSFGGWLTQFDLLAPSDDPLVDGVYLLDVVAEIMGKHSAGFPVTISDVWARTL
SRHFVNGTDASNFWDDTLKHGAGLTLSSIADLNTFANYAQPFPIIIADSLSPNGNESNVL
NETDIDVPLTNPIYEINVFEFGSFDPTLSAFTPTEYLGSPNDSLCATNVDQLCFIEAMSS
NAYNVYNTSVSSQRTGAPVGDANLAYKAAAAVMELVVEAFSQLIPESKVELDVAIVPNPF
HGVAPSTYIDSNETLLQLVDGGEDGETVPFMPLLVKARNVEVIFAIDVHRRQAADTEDNW
TAGLSIIATQDRVAFFTDTYSFPPVPPLESTFLEYNLTKRPTFFGCESTVESGEPLVIYL
ANGGPPLGQPPLTNTSTAQFTYSADEIDKMLSQTFDIATQGIPEGLEKDPLWPACLACAV
VDRSRRRERIERSGVCESCMERYCWS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatctagctttactcctgtctgccgttctctgctgcatcccgctccctgtagcc
agtcagctagcggcatcagtggcttatgcgccagtgcttacgccgtgcccgtctggcgta
tctcttttaagggaggtaggcactgtcgaccaatctctcagcgatggagaacacgcatat
gtagcaggcagacgatctgaagtgttgcctggggcatggggatcgtacctggcggcagta
ctcaagagcatgacaggtgtaacaaacctcccagaatatgtcacagatatactgggcggc
acctatggagaacgtggatacccgcacttcgggatcgtgaccagcggcggcggctacagg
gcagcgatcttcggggctggcgtgctaaacaccctcgacggtcgcaataccacgtcggta
gaagcaggaactggcggtctcctccaagcggccacttaccttgccggcctgtctgggggc
agctggcttgtcacgtcgcttgctcaggcaaacttccccaccttgccagatctcattttt
ggcccctctgcatccgggaaggacagctttgggggctggctgacgcagtttgatctgttg
gcgcccagcgacgatccactcgtggacggcgtatatctcctcgatgttgttgccgagatc
atggggaagcacagcgcaggattcccagtgactatcagcgatgtatgggcgcgaacgctt
tcgcgacacttcgtaaatggaaccgacgccagcaatttctgggacgacactctgaaacac
ggtgcgggactcaccttgtcttcaattgctgacctgaacacattcgcgaattacgcacaa
ccattcccaatcatcatcgctgactcactttcgccaaacggaaatgagtctaatgtgctc
aatgagaccgacatagacgtgccgctgacgaatcctatctacgagattaacgtctttgag
tttggctcgtttgaccctacgctttccgccttcactccaaccgagtacttgggctctcct
aacgacagcctgtgtgccaccaacgttgaccaattgtgcttcatcgaggcgatgtcatcg
aacgcatataacgtttacaacacctcagtaagctcacaacgcacaggggcgcctgtgggt
gatgctaacctagcgtataaggctgctgcagctgttatggaacttgtggtcgaggcgttc
tcgcaattgatccccgagtctaaagtagagctcgacgtggcgatcgtccccaatccattc
catggtgtagctccatctacgtacatcgacagcaacgagacgctgctgcagttagtcgac
ggtggcgaggacggtgagacggtaccgttcatgccgcttctggtgaaggcgcgcaatgtg
gaggtcatctttgcgattgacgttcatagacgtcaggcggcggacaccgaggacaactgg
acggcagggctgtccataatcgcaacgcaagaccgggtggcattcttcaccgacacatac
tccttcccaccagtgccgccgctggaatctacgttcttagagtacaatctcacgaaacgc
cccacgttcttcgggtgcgaaagcactgtggagtccggggagccgctcgtcatttacctc
gcgaacggcggtccgccgctggggcagccgccgctcacgaacacgtcgacggcacaattc
acctactccgcggacgagattgacaaaatgctctcccagacattcgatatcgctacgcag
ggtataccagaagggctggaaaaggacccgttatggccggcgtgtctagcgtgcgctgtt
gtagacagatccaggaggcgggaaaggatcgaacgcagtggcgtgtgtgagagctgcatg
gaacggtattgctggagctga

DBGET integrated database retrieval system