KEGG   Postia placenta: POSPLDRAFT_106657Help
Entry
POSPLDRAFT_106657 CDS       T01162                                 

Definition
(GenBank) predicted protein
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
ppl  Postia placenta
Pathway
ppl01040  Biosynthesis of unsaturated fatty acids
ppl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    POSPLDRAFT_106657
Enzymes [BR:ppl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     POSPLDRAFT_106657
Lipid biosynthesis proteins [BR:ppl01004]
 Desaturase
  First
   POSPLDRAFT_106657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyt-b5
Motif
Other DBs
NCBI-ProteinID: EED80883
JGI: 106657
UniProt: B8PE30
AA seq 394 aa AA seqDB search
MSVPSPPSAANPDVWWWNAGFFISVHIAAILGVWLYPYYAVHRATLALAFALFQISEISI
TVGYHRLYSHRSFRAARSVRVFLALMGAGAMQGSIKRFTDDPVHDPYAATRGLLWSHMGW
IFFKPRYDRLKVIEQDDLRSDPVPLALLIGFVLPPVAGWLWGDPYGAFVWGALVARVLIW
HCTFFVNSLAHWDGLQPYSDENTSKSNLHAFPHDYRSGPCPFDWDPSKWVILALHTLGLA
TGLKRARPDDVSEALIYMAHKHHAPLNSEPPHSSESSSEDEEMWKGAVWTWQEAAGYVRQ
GRGAGRCVLVVDGFAVDVTGYLGEHPGGATLLRKHSVRIGFDPTNADDKTWQEADWAFHG
GYNIHTRAAHKRMRALRVAKISGLDIVKDRSSSI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtccccagtccaccctccgctgccaatccggatgtgtggtggtggaacgctggc
ttcttcatttccgtacacattgctgccatcttaggtgtctggttatatccatactatgcc
gtacatcgggctacccttgcgctcgctttcgctcttttccagatatcagagatttcaatc
accgtcggttatcatcgactctactcacatcggtccttcagggcggctcgtagcgtcaga
gtgttcctcgcactcatgggtgcaggggcaatgcaaggctccattaagcgcttcaccgat
gatcctgtacacgacccttacgctgcaacgcgaggtcttctctggtcacacatgggctgg
atcttcttcaaaccacgctatgatcgcttaaaggtgatcgagcaggacgacctgcggagt
gatccagtcccccttgcactgctgattggatttgtcctcccaccggttgctggatggctc
tggggcgacccatacggtgcgtttgtctggggtgccctcgttgcgcgggttctcatctgg
cattgtacgttctttgtgaactcgctcgcacattgggatggtctgcagccctactctgat
gagaacacatcgaagtccaaccttcatgctttcccccacgactaccgctcgggaccctgc
ccctttgactgggatccgtctaaatgggtcattcttgcccttcacacccttggcctagcc
acgggcttgaagcgcgctcgcccagacgacgttagcgaggccctcatatacatggcccac
aagcaccacgcgcccctgaactccgaaccgccccattcctccgaatccagctcagaggat
gaggagatgtggaagggagcagtctggacatggcaagaagcggcgggctacgtccgtcaa
ggcaggggtgcaggaagatgcgtactggtcgtcgatggcttcgctgtagatgtaacagga
taccttggcgagcaccctggcggcgcgactctcttgcgtaaacactccgttcgcatcggc
ttcgatccaacgaacgcggatgataagacctggcaggaggcagattgggctttccacgga
gggtacaacatccacacgcgcgcggcgcacaagcgcatgcgcgcgctcagggtggcgaag
atctcggggcttgacattgtcaaggatcggtcttcgtcgatctga

DBGET integrated database retrieval system