KEGG   Postia placenta: POSPLDRAFT_25648Help
Entry
POSPLDRAFT_25648  CDS       T01162                                 

Definition
(GenBank) predicted protein
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
ppl  Postia placenta
Pathway
ppl00860  Porphyrin and chlorophyll metabolism
ppl01100  Metabolic pathways
ppl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    POSPLDRAFT_25648
Enzymes [BR:ppl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     POSPLDRAFT_25648
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     POSPLDRAFT_25648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_C Sirohm_synth_M TrkA_N
Motif
Other DBs
NCBI-ProteinID: EED78474
JGI: 25648
UniProt: B8PKX7
AA seq 230 aa AA seqDB search
MATDTSSFTGGSLLLAWQLKGKRVLIVGGGDVASGRIESVLVADALVTLIAPRDGLHPLT
KRFIESSDRITYHDRTFAGPEDLVDVDMVLTAIDDVETSRTICAMARALKVPINVADIPP
SCDFYFGSQIRSGPLQIMISTNGQSPKLANIIRRRIENSLPEHAGEAIEKVGQLRNKLRE
RAPGVGGELGKRRMRWMVDVCTAWEMEDLAALDGEMMAKLLDDGWEYNRV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggacacttcatcgttcaccggcgggtctctcctgctcgcatggcagctcaag
ggtaaacgcgtactcattgtcggcggcggcgacgtcgcatcgggccgcatcgagtccgtt
ctggtcgccgacgctctcgtcacgctcatcgcgccgcgcgacggacttcacccccttacc
aagcgcttcatcgagtcgtcggaccgcatcacgtaccacgaccgcacgtttgcaggcccg
gaggatctcgtcgacgtggacatggtcctgacggccatcgacgacgtggagacatcgcgg
acgatctgcgccatggcgcgcgccctcaaggtccccatcaacgtcgcggacatcccgccg
tcgtgcgacttctacttcggctcgcagattcgcagcgggccgctgcagatcatgatctcg
acgaacggccagagcccgaagctcgcgaacatcatccggcggcgcatcgagaacagcctc
ccggagcacgcgggcgaggcgatcgagaaggtcgggcagctgcggaacaagctgcgggag
cgcgcgccgggcgtgggcggggagctgggcaagcggcgcatgcggtggatggtggacgtg
tgcacggcgtgggagatggaggacctggcggcgctggacggcgagatgatggcgaagctc
ctcgacgacggctgggagtacaaccgggtg

DBGET integrated database retrieval system