KEGG   Postia placenta: POSPLDRAFT_57386Help
Entry
POSPLDRAFT_57386  CDS       T01162                                 

Definition
(GenBank) hypothetical protein
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
ppl  Postia placenta
Pathway
ppl00500  Starch and sucrose metabolism
ppl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    POSPLDRAFT_57386
Enzymes [BR:ppl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     POSPLDRAFT_57386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cellulase
Motif
Other DBs
NCBI-ProteinID: EED81384
JGI: 57386
UniProt: B8PCL9
AA seq 786 aa AA seqDB search
MSGLEHEHGSLTPPQPIQDVEGRPASVGRADSQYTADALGVPQAGLNPDPSLPSTPHESY
ATPGLGTSDNTPPFGTSSDAINANTSDAAAAAGVPATKETASTGSAEALAGTGTKGAGKA
PWYKRPIVWLAAFIALAIVVLVVVLPVWFVAVKPHRDHNTTSGTGKSGGPNPESPSGATS
GGNGSTITAADGTSFTYINNFGGSWVYDAENPFNNSARPNSWTPPLSEPWNWSTDRIWGV
NLGGLFELEPFISPELFQAHPNSVDEWTLDTDLRAGSNGSQNILAQMENYYNTFITEQDI
AEIAGAGLNWIRLPIPFWAIDVWDNVGVDSNGTVVSEPFLARVSWSYILRVLGWARKYGL
RINLDLHTIPGSQNGYNHSGKLGIVNFLNGVMGVANAERALEYIRVIAEFISQAEYQPVV
PLFSIVNEPLLATIGKDTLTTFYLRAHDMIRNITGIGEGHGPFIAIHDGFMGTAYWAGFL
QGSDRIALDTHPYFAFDNQPNNQPVNVTVANGSSLYGGQWPLLACNSWGAEMNNSREQFG
VTIAGEFSNAINDCGLWVRGVNTSADYVGNCDYWENWESWSDETKAGLKQFALASMDALG
DWFFWTWKIGNSSTSNSPQAPLWSYKLGLDNGWMPLDPREASGACESLGYIPVAWNDSFA
SWATGGAGAGTIAPTSVSQYGVWPPATINNVPTESISYLPQYTSTATVVSLPPASTYTAA
TVSTGNGWYDAQDRASAPTPIAGCTYPDAWSAVGSPIATAGCGAVAYAKREVPEPVVTAP
PARRGL
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcttggagcacgaacacgggtccctcacgcctccacaacctatccaggacgtg
gaaggacggcccgcctctgtaggacgtgccgactcgcagtacacagcggacgctctgggc
gttccacaagcaggcctcaacccggacccatcgctcccttcaacgccccacgagtcctat
gcgacacctgggcttggcacgtcagacaacactccacctttcgggacttcctcagacgca
atcaacgcaaatacatcagacgcggctgctgcagccggtgtccccgcgacgaaggagact
gcgtcgacaggctcagcagaggcgttggcgggtacggggacaaagggcgctggcaaggcg
ccgtggtacaagcgacctatcgtctggctcgcggcgttcattgcgcttgcaatcgtcgtg
ctcgttgtcgtgctgccggtatggttcgttgccgtcaagccccatagagaccacaatacg
acatcgggcactggcaagagcgggggtcctaatccggagagcccatctggtgcgacgagc
gggggcaacggtagcacgatcacagcggccgacggcacgagtttcacgtacatcaacaac
ttcggtggctcctgggtctacgacgcggagaaccccttcaacaactcggcacgaccgaat
tcgtggacgccgcccctctctgagccatggaactggagcacggaccgcatttggggcgtc
aacctgggcgggctgttcgagctggagccgttcatctcgccggagctgttccaggcgcac
ccgaactcagtggacgagtggacgcttgacaccgacttgcgcgccggcagcaatgggagc
caaaatatccttgcgcagatggagaactactacaacacattcattacggagcaggatatt
gctgagatcgctggtgctggtttgaactggattagactgcctattcccttctgggcgatc
gatgtctgggacaatgtgggcgtagactcgaatgggactgtggttagcgaaccgttcctc
gcaagggtatcctggtcatacatcttgcgcgtgcttggctgggcgcgtaagtacggactg
cgtatcaacctcgacctgcacacgatccctggctcgcagaacggctataaccattctggc
aagctgggtattgtcaacttcctgaacggcgttatgggtgtcgcgaacgcggagcgtgcg
ctcgagtacattcgcgtgatcgctgagttcatatcgcaggcggagtaccagcctgtagtg
ccccttttcagcattgtgaacgagccgctgctggcgactattgggaaggatacactcacc
actttctacttgcgcgcgcacgacatgattcgaaatatcaccggcattggggagggacat
gggccgttcattgcgattcacgatggcttcatgggcacggcatactgggcagggttcctc
caaggttcagatagaatcgccctggacacgcacccctacttcgcgtttgacaatcagcca
aacaaccagcctgtcaatgtgaccgtggcaaacggatcctcgctgtacggtgggcagtgg
ccattgcttgcctgcaactcctggggcgccgagatgaataacagccgcgagcagttcggt
gtcacgatcgcgggagaattcagcaatgcgatcaatgattgtggtctttgggttcgcggt
gtgaacacctccgcagactatgtggggaactgtgactactgggagaattgggagagctgg
agcgacgagacgaaggccggcctgaagcagttcgcactcgcgagcatggacgcgctcggc
gactggttcttctggacatggaagattggcaactcttcgacgtcgaacagcccgcaagcg
ccactctggtcgtacaagctcgggctcgacaatggctggatgccgcttgacccgcgcgaa
gcttctggcgcgtgcgaatcgctcggctacatacccgtcgcttggaacgactccttcgcg
tcttgggcaaccggcggggcgggtgcgggaaccattgcgccgacttcagtgtcgcagtat
ggcgtatggccaccagcaacgatcaataacgtccccacggagtctatttcctaccttccg
cagtacacgtccaccgcaactgtcgtcagcctgccgcccgcgtcgacgtataccgccgcg
acggtaagcacgggcaatggctggtacgacgcgcaggaccgtgcaagcgcaccgacgccc
atcgcgggctgcacatacccggatgcatggagtgcagttggctctccgattgccacggcg
gggtgtggagcagtggcgtacgcgaagcgcgaggtgcccgagcccgttgtcactgcgccg
cccgcacggcggggcctgtga

DBGET integrated database retrieval system