KEGG   Postia placenta: POSPLDRAFT_87541Help
Entry
POSPLDRAFT_87541  CDS       T01162                                 

Definition
(GenBank) predicted protein
  KO
K12343  3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
ppl  Postia placenta
Brite
Enzymes [BR:ppl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     POSPLDRAFT_87541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh DUF1295
Motif
Other DBs
NCBI-ProteinID: EED81638
JGI: 87541
UniProt: B8PBW1
AA seq 297 aa AA seqDB search
MPTVEQAQLWYNTGKTWFTIMPPLICPLTFIIDAPFGRFTPSQNSILLVDGIKSWMFMEL
VSPLMFSYTYLNAPLTRSPHPPLTLSHSSSLLSALFLTHYLNRAIISPLRTPSRSKSHVS
VALSAVFFNVVNGFLLGAYLSSPSAQAFLAGAFARPSFWAGIGLWAAGLVGNIVHDEVLL
NIRRTAKAKGKAKADDDSRGKNKQEHYAVPHGYLYSLISYPNYFCEWCEWFGFALAAAPP
PSFASFGVLLATLSPPYLFFLSEVLLMLPRAYKGHRWYHKRFPDYPRDRKAVIPFLF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgtcgagcaggcgcagctatggtacaacacgggcaagacgtggttcactatt
atgccaccgctcatatgcccgttaacgttcatcatcgacgcccccttcggccgcttcacg
ccctcgcagaatagcatcctgctcgtcgatggcatcaagtcctggatgttcatggagctt
gtctcgccgctcatgttcagctacacgtacctgaacgcgcccctcacaaggtctccacac
ccacccttgacgctctcgcattcctccagcctcctctccgcgctcttcctgacccactat
ctcaaccgcgcgatcatctcgccgctccgcacgccctcgcgctccaagtcacacgtcagc
gtcgcgctctccgccgtgttcttcaacgtcgtgaacggcttcctccttggcgcgtatctc
tcctcgcctagcgcacaggcgttcctcgcaggcgcgttcgcccgtccgtccttctgggcg
ggcatcggcctctgggccgcaggcctcgtcgggaacatcgtgcacgacgaggtgctgctc
aacatccgccgcaccgccaaggcgaagggcaaggcgaaagccgacgacgacagcagggga
aagaacaagcaggagcactacgccgtcccgcacgggtacctgtacagcctcatctcgtac
ccgaactacttctgcgagtggtgcgagtggtttggctttgcgctcgccgccgcgccgccg
ccctcgttcgcgtccttcggagtgctgctggctacactctcgccaccgtatctgtttttc
ctttctgaggttttgttgatgcttcctcgcgcatacaagggacacagatggtaccacaaa
cgctttccggactacccacgtgatcggaaggcggtcatcccattcctgttttga

DBGET integrated database retrieval system