KEGG   Postia placenta: POSPLDRAFT_87740Help
Entry
POSPLDRAFT_87740  CDS       T01162                                 

Definition
(GenBank) predicted protein
  KO
K16794  platelet-activating factor acetylhydrolase IB subunit alpha
Organism
ppl  Postia placenta
Pathway
ppl00565  Ether lipid metabolism
ppl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    POSPLDRAFT_87740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ppl03036]
    POSPLDRAFT_87740
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppl04147]
    POSPLDRAFT_87740
Chromosome and associated proteins [BR:ppl03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    POSPLDRAFT_87740
Exosome [BR:ppl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   POSPLDRAFT_87740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160
Motif
Other DBs
NCBI-ProteinID: EED84295
JGI: 87740
UniProt: B8P4B0
AA seq 438 aa AA seqDB search
MSILSERQKDDLNKSIAEYLYAQDLTEIADSLCARLSLDYKSEPNSKYAGLLEKKWVSVI
RLQKKLIESENRYTALQEDIAAGPARRRDAQVDWLPTAPARYTLTSHRAPITRVAFHPTF
SLLASASEDTTVKIWDWETGSFERTLKGHTREVWGVDFDSKGSFLATCSSDLSIKVWDTQ
QWDNAGYSGKTLRGHEHTVSTVKFLPGDDLIASASRDKTIRIWEVATTFCIRMITGHEDW
VRMTVPSTDGTLLGSCSSDNTARVWDPTSGVMKMEFRGHGHIVEVIAFAPLASYAAIREL
AGLKAATKAPGAYIATGSRDKTVKIWDVHSGQELRTLSGHNDWIRGLVFHPSGKHLLSAS
DDKTIRVWELSTGRCMKVVEAHSHFITCLAWGPPVQAGGDIKAASGSGNLRGTGADTERR
MNVLATGSVDQTVCVWLP
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtctatactgtctgaacgtcaaaaggacgatctcaataaatccattgcggagtatctg
tatgcacaagaccttacagagattgccgacagcctatgcgctcggctgagtctcgactat
aagtctgagccaaactcaaagtatgcgggtttgttagagaagaagtgggtcagcgtaatc
cggctacagaagaaacttattgaatccgagaaccgttacactgcgctgcaagaagatatt
gctgcgggaccagcacgccgtagggatgcccaagttgattggctgcccaccgcgcccgca
cggtacacgctaactagccatcgtgcgcccatcacacgtgtcgcattccatcccacattc
tcgctgcttgcgtctgccagcgaagacacgacggtgaagatatgggactgggagacgggc
agctttgagcggacgctcaagggacacacgagggaggtgtggggcgtcgatttcgattcc
aaggggtcgtttctcgcgacgtgctcatcggacctcagcatcaaggtgtgggacacgcag
cagtgggacaatgccggatatagcggaaagaccctgcgcggacacgagcatacggtgtcg
actgtcaagttcttgcctggggacgaccttatcgcaagtgctagcagggacaagacaatc
aggatctgggaggttgcaacaaccttttgtattagaatgatcactggccacgaagattgg
gtgcgcatgactgtgccatccaccgatgggacgctacttggaagctgctcgagcgataac
accgcacgtgtatgggatccaacatcaggcgtcatgaagatggagttcagagggcacggt
catatagtcgaggtgattgcatttgctccgctcgcatcgtacgccgcaattcgcgagctt
gcgggattgaaggcggctacgaaagctccgggcgcatatattgccacgggctctcgggac
aaaacggtcaagatatgggatgtccatagcgggcaggaactgaggacgttgagcggccac
aacgactggatacgggggcttgtcttccatccttcgggtaagcacctgctctccgcatcg
gatgacaagacgatccgcgtctgggaactttccacggggcgctgcatgaaagtggtagag
gcgcactcccatttcatcacctgcctggcatggggcccgcccgtgcaggcaggcggagac
attaaggctgcctcaggctccgggaacttgaggggcactggtgcagacactgagaggcgg
atgaacgtgttggccacaggaagtgtggaccagacggtttgtgtgtggttgccgtga

DBGET integrated database retrieval system