KEGG   Postia placenta: POSPLDRAFT_94935Help
Entry
POSPLDRAFT_94935  CDS       T01162                                 

Definition
(GenBank) predicted protein
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ppl  Postia placenta
Pathway
ppl00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ppl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    POSPLDRAFT_94935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ppl03036]
    POSPLDRAFT_94935
Enzymes [BR:ppl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     POSPLDRAFT_94935
Chromosome and associated proteins [BR:ppl03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     POSPLDRAFT_94935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET API5 DUF5320
Motif
Other DBs
NCBI-ProteinID: EED82108
JGI: 94935
UniProt: B8PAI0
AA seq 1337 aa AA seqDB search
MRDLSRDDDFLSHLLVEKLGTGAAPLVVHKMDAGRTIPKANPDSLMQIVRTLVTAKGPPQ
AAIRVAVDELLTHASRYFELYLPTGSIEIAHTSRYSHKTGKSELCILATRPLNTGTVITE
LKGSMADLTDEEDMELKRIDATCVDGVQIRRDFSVIHSKQLKKNHLFLGPARFVNHDCDH
NVELFREGRYITFRVIKPIGVGEEVTAHYGDGYFGRDNRHCLCETCEKLGRGGYATDAED
DEASDSGPGSPLQPRGRRAAPSVDSDSDSEEEEAVVVNVNARSTRRGVYAVVKDKERIKG
KGKEKAAASELVEGAEIELEAEVEQDISSDLTSLPPSRSSAPVPPSKGNGLMTPEPDPQL
QEWLRGVGAEGASVPSTPTKGGMRGASTSTSVLSTPTSFRSVIATRAQKAKKAATAEDDV
AEDEFPDASASVSVSVSARGSGRGRGRRGRGRGFRGRGRGGRSRADMDQPRQLETPPLTA
ESASVSVATSIRSSSRIRSRGGDVTNLSRLTTPVPVSSSLSRAVEPTGRKDKGKERASEE
SESESVSEDGEDEPEPEPEMRTLRPRASLHGHLLAAHGLEHPVMERAEAPRGEDGKLLPT
CITCRNVLPVIHVEGKPVWGLVLGRTGKRGRPKKNIEAECPRCLRHSEIYGLKWPERRPG
DRSSAFLPTPRETRNSTPITHSALAALDRKLAFAKHGYAMPKRPYKRRREVEETEDGPPA
KRAKPIDKPAATSTGRPRGRPPKHRVGMSTKAKQLLKVDTLKVIPKASPVKAKAAPVAKA
SASTNSGRRSGRTRVPSIKLRESVPPRLRSQSRAGHSASRPPTSSSTSASGSSSSLSGPE
TESVVGSLMEPPSTPVKRKREGEGEEDSPKVMTPKSLAVAAQPRESNGRFGKKSHTNGRF
KRNNSALSGAGRRSRQQRALMRLRRLTKKNISTPRCDNEIHPGSEGSSSDLVTSGTSDEA
SSLSRKRPIEDEREDEDMAELSAKRIRIGEDLEDLDLDAVSDGDQDEEEDDAMGDSEPEY
MFRPALFSSRGNSGAGLLCAPNPMSFARRKWSVTPIISQNSVDGGQSSTDDNDTDLPPTP
EDDQDAPVVNAEELAEQLECAEDEDGDSEHTMSVSYSRPILSAPALGGKLLKPSPHNLAR
RRWAPPPPPKVQEERANGLLNRFGDLEYPYTSDEEDNDIRGPAEGLLELARSPKSPILAA
RSSRASTISDLSAPAALLELSRTPKPTGPSSNSRGISLGSTGSTGSSELVVEQLVSMSPS
PRPASLGSPWSGSPRSIGGTPTIQQSPSLPWKQISIREADIPYLKDRSRSFSANLHSSPV
TFERARWCDPSSESDSS
NT seq 4014 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacctttcgcgcgacgacgacttcctctcccacctactcgtcgagaaactcggt
accggcgctgcacccctcgtcgtccataagatggacgccggccgcaccatccccaaggcc
aaccccgactcgctgatgcagatcgtcagaacactggtcactgccaaggggcccccgcag
gccgcgatacgcgttgcagtcgacgaacttctcacgcatgcctcgcgttatttcgaatta
tatctccccacaggctctattgagatcgcgcatacatcgcgctattcacacaagactgga
aaatccgaactatgcatcctcgcgacgcgcccgctcaacacaggcactgtcattacagag
ttgaaagggtcgatggccgacctgaccgatgaggaagacatggaactaaaacgcatcgac
gcgacgtgtgtcgatggtgtgcagatccgaagagacttcagcgtcattcattcaaagcaa
ttgaagaaaaaccatctttttttaggcccggcgcggttcgtcaaccacgactgcgaccac
aatgtcgagctcttccgtgaagggcggtacatcactttccgagtcatcaagcccatcgga
gttggggaggaagtcaccgcgcactacggagatggctacttcggccgggacaatcgacat
tgtctctgtgagacgtgcgaaaagctcgggcggggcggatacgctactgacgccgaagac
gacgaggcctccgattctggcccagggtcgccgttgcagccccgcggacgtcgcgctgcc
cccagtgttgactcggactcagactcggaggaagaagaggctgtggtcgttaacgtgaac
gcacgcagtacgcggcgcggggtgtatgcggtcgtgaaggacaaggaacgcatcaaggga
aagggcaaagagaaggccgcggcgtctgagctcgtggaaggtgcggagatcgagctcgag
gcggaggtcgagcaggacatctcgtcggacctgacgtcgctccccccgtcgcgttcatcg
gcgcccgttcccccctcgaaaggcaacggacttatgacaccagaaccggatcctcaacta
caggaatggcttcgtggcgttggcgcagaaggcgcatctgttccgtccacgccgacgaaa
ggtggaatgcgcggagcgagtacgagcacgagcgtgctgtcgaccccgacaagcttccgt
tccgtgatcgcgacgcgcgcacagaaagcaaaaaaggccgcgaccgctgaggatgatgtt
gcggaggacgaattcccggatgccagtgccagtgtcagtgtcagtgtcagtgcaaggggc
tctggacgtggacgaggccggaggggcagaggcagaggattccgtggacgaggccgtggt
ggacgctcacgagcggacatggatcagccccgccagcttgagacgccaccattgacggcg
gagtcggcgtcggtgtccgtggcgacgagtattcggtcaagctcgcgcatacgctctcgc
ggcggggacgtcacaaacctctcgcgcctgaccacgcctgtgccagtcagctcgtccctg
tctagagcggtcgagcctactgggcggaaagacaagggcaaggagcgcgccagcgaagag
tccgagtctgaatctgtttccgaagatggagaggacgagccggagccggagcctgagatg
cggacattgcgcccgcgcgcgtcgcttcacgggcacctgctcgcagcgcatggattggag
cacccggtgatggagcgagcagaggcgccgcggggcgaggatgggaagctactgccgaca
tgcataacgtgccggaacgtgctaccagtgatacatgtagaaggcaagccagtgtggggg
ctcgtgctgggacggacgggcaagcggggtcgacctaaaaagaacatcgaggcggagtgc
cctaggtgcctacgccatagtgagatatacggtctcaaatggccagagcgtcgtcctggt
gacaggagcagtgcattccttcctacaccacgggagacgcgcaattccacccccattacc
cattccgctcttgctgctcttgaccgcaagttggcattcgcaaagcatggatatgcaatg
cccaagcggccttacaagcgccgcagggaagttgaagagactgaggacggcccacctgcc
aaacgcgccaaacccatcgataagcctgcggcgacgagcacaggacgcccgcgcggccgc
cctccaaaacatcgagtcggaatgtcgacgaaggcgaaacaattactcaaagtcgacaca
ctcaaggttatacccaaggcttcccctgttaaggctaaggcggcaccggttgcaaaggct
agcgctagcactaacagcggccggcgcagtggacgcacgcgggttccgagcatcaagctg
cgagagagcgtaccccccagattgcggtcgcagtcgcgggctgggcatagcgcgagtcgc
ccgccgacttcctcttcgacgtctgcgagcggttcatcctcctctttgtcggggccggag
actgaaagtgtggtgggcagcctcatggagccacctagtactcctgtgaagcgaaaacga
gaaggagaaggcgaagaggacagcccgaaggtcatgactcctaagtcgcttgctgtggcg
gcccagccccgagagtcgaacggccgcttcgggaagaagtcgcatacgaacgggcggttc
aagcggaataattctgcgctatctggtgctggcaggcgctctcgacagcaaagggcgctg
atgcgtctgcgtcgactcaccaagaaaaacatcagtacaccgagatgtgacaacgaaatt
catcctggatctgaaggcagctcttcagacttggttacttcgggaacgtcagacgaggcg
agcagtctgtcacgcaagcggcccatagaggatgaaagggaagacgaagacatggctgag
ttgtctgccaagaggattcgtattggcgaagatctcgaggatcttgatctcgatgctgtc
tccgatggagatcaagatgaggaagaggatgacgctatgggcgattcagaacccgagtat
atgttccgtccagcattgttctcgtctcgaggcaactctggtgcaggtcttctttgtgcg
ccaaatcccatgtccttcgcgcgccgcaaatggtccgttacccccatcatctcgcagaac
tccgtcgatggcggacagtcttcaacagacgataatgacaccgacctgcctcccacgcct
gaggacgaccaggatgcgcccgtcgtcaacgcagaagaactcgcggagcagctggaatgc
gctgaggatgaggatggagacagtgaacataccatgtctgtgtcttattcacgtcctatc
ttgtccgcgcctgcgttgggaggcaagttgctgaaaccttctcctcacaaccttgctagg
cgccgttgggcgccgccgccgccgccaaaggttcaagaagagagagccaatgggctcctc
aatcgttttggtgatttggaatatccgtatacttccgacgaggaggacaacgatataaga
ggtcccgcggaggggctattggaacttgctaggtcgccgaagtctcctatacttgctgca
aggtcaagtcgtgcgtcgaccatctccgatcttagtgctcctgctgcactgttggagctg
tcgaggacaccgaagcccacaggcccgtcctcgaattcccgcggaatttcccttggatca
acagggtccaccggcagctcagagttggttgtcgaacaactagtgagcatgtctccttcg
ccgcgccctgcatctttaggttcgccttggtcagggtctcctcgatcgattggcggtacg
ccaacgatccagcagtcaccaagcctgccatggaagcagatttccatccgggaggctgac
attccttatctgaaggaccgctctcgttcattctccgccaacctacacagctcccctgtg
actttcgagcgtgcacgatggtgtgatccatcgtctgaatcggactcttcatga

DBGET integrated database retrieval system