KEGG   Postia placenta: POSPLDRAFT_95562Help
Entry
POSPLDRAFT_95562  CDS       T01162                                 

Definition
(GenBank) predicted protein
  KO
K02358  elongation factor Tu
Organism
ppl  Postia placenta
Brite
KEGG Orthology (KO) [BR:ppl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ppl03012]
    POSPLDRAFT_95562
   03029 Mitochondrial biogenesis [BR:ppl03029]
    POSPLDRAFT_95562
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppl04147]
    POSPLDRAFT_95562
Translation factors [BR:ppl03012]
 Eukaryotic Type
  Elongation factors
   POSPLDRAFT_95562
 Prokaryotic Type
   POSPLDRAFT_95562
Mitochondrial biogenesis [BR:ppl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    POSPLDRAFT_95562
Exosome [BR:ppl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   POSPLDRAFT_95562
  Exosomal proteins of breast cancer cells
   POSPLDRAFT_95562
  Exosomal proteins of colorectal cancer cells
   POSPLDRAFT_95562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU_D3 GTP_EFTU_D2
Motif
Other DBs
NCBI-ProteinID: EED82410
JGI: 95562
UniProt: B8P9T1
AA seq 141 aa AA seqDB search
MFHKELDRGEAGDNMGALLRGVKREQIRRGQVIAAPGSIKAVKKFQAQIYVLTKDEGGRY
TPFMDNYRPQLFVRTADVTCGLHWPEGTADAAEKMVMPGDNVEMVCDLMHDVAAEIGTRF
TLREGGKTVGTGIVTEILTFA
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgttccacaaggagcttgatcgcggtgaggccggtgacaacatgggtgccctccttcgt
ggcgtcaagcgtgagcagattcgccgtggacaagtcatcgctgctcctggtagcatcaag
gccgtcaagaagttccaggcccagatctatgttttgaccaaagacgaaggcggacggtac
acacctttcatggacaactaccgcccacagctcttcgtgcgtactgcggacgtgacgtgc
ggtctccactggcctgagggcactgctgatgcggccgaaaaaatggtcatgcccggtgat
aatgtcgagatggtctgcgacttgatgcacgatgttgcagcagagattggtacccgtttc
actcttcgtgaagggggcaagactgtcggcaccggtattgtgacggagatcttgacgttc
gcgtag

DBGET integrated database retrieval system