KEGG   Planococcus plakortidis: BBI15_02970Help
Entry
BBI15_02970       CDS       T04812                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ppla  Planococcus plakortidis
Pathway
ppla00564  Glycerophospholipid metabolism
ppla01100  Metabolic pathways
ppla01110  Biosynthesis of secondary metabolites
Module
ppla_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ppla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBI15_02970
Enzymes [BR:ppla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BBI15_02970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ANU19240
UniProt: A0A1C7E5W9
Position
1483973..1484746
Genome map
AA seq 257 aa AA seqDB search
MKRWMYQSMIELGNGKTSSAALKRFAQSAISRKAIPGFINAYKIDLGDVDRPSGRYTSLH
DFFTRSLKAGTRPVAGADLVSPVDGRVEVHGAIQEGSRFQVKGIGYSLAELLGSEQMAER
YANGQYAILYLSPADYHRIHSPADGEVLKQYMLGDKSYPVNRLGLTYGKSPISGNRRLIT
ELKTPHGQVLVVKVGAMYVNSIELTEFGKVWKKGGEVAHFSFGSTVALFFESGHLQFDAK
IHDGDRIKVGEPLAYMV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatggatgtatcaatcgatgatcgaattgggcaacggaaaaacaagttctgct
gcgttgaaacgctttgcccaatcagccatcagccgaaaagcaatccccggattcatcaat
gcctataaaatcgatctcggcgacgtcgaccgcccgagcggcagatacacaagcttgcac
gacttctttacgcgcagcctgaaagctggtactcggccggttgccggtgccgatttggtc
tccccggtcgacgggcgtgtcgaggtccatggcgcaatccaggaaggcagccggtttcaa
gtcaaaggcatcggttattctctcgctgaactgctcggcagcgaacagatggctgagcgc
tatgcaaatggccagtacgcaattctctatctatcccctgcagactatcaccgcatccat
agcccggcagacggtgaagtcttgaagcaatatatgcttggcgacaaatcctatccggtc
aatcggcttggcctgacgtacgggaaatcgccgatcagcggcaaccgccgtctcatcact
gaactgaaaacccctcatggtcaagtattggtcgtgaaagtcggggcgatgtatgtcaac
tccatcgaattgacggagttcgggaaggtttggaaaaaaggcggggaagtcgctcatttc
agcttcggttcaacggtcgcgttattctttgaaagcggacatctgcaattcgatgcgaaa
atccatgacggcgaccggatcaaggtgggagaaccccttgcatatatggtataa

DBGET integrated database retrieval system