KEGG   Planococcus plakortidis: BBI15_11865Help
Entry
BBI15_11865       CDS       T04812                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ppla  Planococcus plakortidis
Pathway
ppla00450  Selenocompound metabolism
ppla00970  Aminoacyl-tRNA biosynthesis
ppla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppla00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BBI15_11865
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBI15_11865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppla01007]
    BBI15_11865
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ppla03016]
    BBI15_11865
Enzymes [BR:ppla01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BBI15_11865
Amino acid related enzymes [BR:ppla01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BBI15_11865
Transfer RNA biogenesis [BR:ppla03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BBI15_11865
 Prokaryotic type
   Other AARSs
    BBI15_11865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 Zn-ribbon_8 zf-Mss51
Motif
Other DBs
NCBI-ProteinID: ANU20849
UniProt: A0A1C7EAT8
Position
45108..47075
Genome map
AA seq 655 aa AA seqDB search
MTAKNKTFYLTTPIYYPSGKFHIGTAYTTVASDAMARYKRLRGFDVRFLTGMDEHGQKIE
EKAREAGKEPQAFVDDMAEAAKKVWEVMDISYDDFIRTTEARHKKGVEKIFQTFLDNGDI
YKGEYEGWYCTPCESFFTESQLEDGNCPDCGRPVHKVKEESYFFNMKKYADRLLDYYDKH
VEFIEPESRKNEMVNNFIKPGLEDLSVSRTSFDWGIPVPGDPKHVIYVWVDALSNYITSL
GYGSDDESHFNKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKVFAHGFIMMKDGK
MSKSKGNVVYPEMLVERYGLDAARYFLLRELPFGSDGVFSPESFVERTNYDLANDLGNLL
NRTVSMINKYFDGEVPQVDGFKTDFDETLQTIAKNTVAVYEEHMEKMQFSLVLSEVWTLI
SRTNKYIDETQPWVLAKEDGDRTQLASVMAHLAESLRMTAVMLQPFLPNAPKQIIEQLGL
APEFLEWQTLESFGAIPAGTTVVKKGTPIFPRLEVEPEVAYIRDQMRGGAAPEEEQAPVE
AIPEKPDTPEITIDDFMKVDLRVATVTACEPVKKTDKLLKLQVDMGYETRQVVSGIAEHY
KPDELIGRKVIIVANLKPVKLRGELSQGMILAGQQNGYLTIASVDQKLPNGTQVK
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccaagaacaagacattttatttgacgactcctatttactatccgagcggaaaa
ttccatatcggaacggcttacacgaccgttgcatccgatgcgatggcccgctacaaacgc
ctccgcggcttcgatgtccgttttttgacgggcatggatgagcacggccagaaaatcgaa
gaaaaagcccgcgaagccggcaaagaaccgcaagcatttgtcgacgatatggcagaagcg
gcgaaaaaagtatgggaagtcatggacatcagctatgacgatttcatccgtacgacagaa
gcccgccataagaaaggcgtagaaaagattttccaaacattcctcgataatggcgatatc
tacaaaggggaatacgaaggctggtattgcacgccttgcgaatccttcttcacggaatcg
caattagaagacggcaattgcccggattgcgggcgcccggtgcataaagtgaaggaagaa
tcgtatttcttcaatatgaaaaaatacgcagaccgcttgcttgattattacgacaagcat
gtcgagttcatcgagccggaatcgcgcaaaaacgagatggtcaataatttcatcaagcca
ggccttgaagacttgtctgtttcccggacttccttcgactggggcattccggttcctggg
gatccgaagcatgtcatttatgtatgggtcgatgctttatcgaattacatcacctcactc
ggctacggctcggacgacgaatcccatttcaataaatactggcctgcggatgtgcacgtg
gtcggaaaagacatcgtgcgtttccatacaatctactggccgatcttcctcatggcgctc
gatctgccattgccgaagaaagtattcgcacatggctttatcatgatgaaagacggtaaa
atgtcgaaatcgaaaggcaatgtcgtctatccggaaatgctcgtagagcgctacggactg
gatgcagcgcgttatttcctcttacgtgaactgccatttgggtccgacggcgtgttttcg
ccggaatctttcgtcgagcgtaccaattacgacttggcgaacgatctcggaaacttgctg
aaccgcaccgtctcgatgatcaataaatacttcgacggggaagtgccacaagtcgacggc
ttcaaaaccgacttcgacgagactttgcagacgatcgctaaaaatacagtggccgtttat
gaagagcatatggaaaaaatgcagttcagcctcgtgctgagtgaagtatggacattgatt
tcccgcacgaataaatacatcgatgaaacgcagccgtgggtattggcgaaagaagacggc
gaccgcacgcaactcgcatcggtcatggcgcatctcgccgagagcttgcgcatgaccgcc
gttatgctgcagccgttcttgccgaatgcaccgaagcagatcatcgaacagctcggactt
gcaccggagttcctcgaatggcagacattagagtcattcggcgcgattcctgcaggtacg
accgttgtgaaaaaagggacgccgattttccctcgtcttgaagtggagccggaagtggcc
tatatccgcgaccaaatgcgcggaggggcggcgccggaagaggagcaagcaccggtagag
gccatcccggaaaaaccggatacccctgaaatcacgatcgatgatttcatgaaagtggat
ttgcgcgtggcgacggtgacggcatgcgaaccggtaaagaaaaccgataagttgttgaag
ctgcaagtggatatgggctatgaaacacgccaagtcgtttccggcattgcggaacattac
aagccggatgaactcatcggccgaaaagtcatcattgtcgccaatttgaaaccggtcaaa
ctgcgtggcgaattatcgcaaggcatgattctcgccggtcagcaaaatggctacttgacc
atcgcttctgtagaccaaaagttaccgaacggcacacaagttaagtaa

DBGET integrated database retrieval system