KEGG   Paenibacillus polymyxa SC2: PPSC2_00530Help
Entry
PPSC2_00530       CDS       T01335                                 

Gene name
dcoH
Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
ppm00790  Folate biosynthesis
ppm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PPSC2_00530 (dcoH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppm04147]
    PPSC2_00530 (dcoH)
Enzymes [BR:ppm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     PPSC2_00530 (dcoH)
Exosome [BR:ppm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPSC2_00530 (dcoH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ADO54092
UniProt: E3EEW9
Position
135058..135357
Genome map
AA seq 99 aa AA seqDB search
MPFTQEEIEAHLEKLEGWELEEGRWIVRKYNFSSFMKGIAFVDEVAAISEAFNHHPFITI
DYKTVTLRLTSWDDGGIMAVDIKEAQQYNEAFEKMRSSH
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgccttttacacaagaagagattgaagcacatctggagaaactggagggctgggaactg
gaggaaggacgttggatcgttcggaaatataatttttccagttttatgaagggaattgca
ttcgtggatgaagttgccgctatatctgaggcattcaatcaccatccatttattacgatt
gattacaagaccgtgactctgcgtttgacctcttgggacgatggcggtattatggccgta
gatattaaggaagcccaacaatataatgaagcttttgaaaaaatgcgcagcagtcattga

DBGET integrated database retrieval system