KEGG   Paenibacillus polymyxa SC2: PPSC2_03510Help
Entry
PPSC2_03510       CDS       T01335                                 

Gene name
srfJ1
Definition
(GenBank) glycosyl hydrolase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
ppm00511  Other glycan degradation
ppm00600  Sphingolipid metabolism
ppm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    PPSC2_03510 (srfJ1)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PPSC2_03510 (srfJ1)
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PPSC2_03510 (srfJ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C
Motif
Other DBs
NCBI-ProteinID: ADO54677
UniProt: E3EGN8
Position
complement(790641..791984)
Genome map
AA seq 447 aa AA seqDB search
MSNQTIQWFSTSKANAWKSQAHHLTETQESADLTLTGEAYQLVEGFGGCFNELSYVALNH
LDSEEREQVLHALFHPEGEHKFTICRLPIGASDYALEWYSHNETDGDMEMKHFSIERDQQ
YLIPFIREALQLNPDLKLFASPWSPPTWMKSPKAYNYGTLRWEKDILKAYALYFVKFVQA
YRKAGITIHQVHVQNEVIADQKFPSCVWTGEQLREFIRNYLGPAFEEHGLDTEIWLGTIN
APDPWEELMKKTSTGFDEYAHTVLSDPEAYKYIKGVGYQWAGKNAIQRTVASYPELRYMQ
TENECGNGENSWDYAKYVYNLYQHYFTNGVNAYIYWNMVLEPKGKSTWGWEQNSMITVDP
ANRKPILNPEYYVMKHFSHFVLPGARRIGIRGSWAGNAVAFQNTDGQKVLVIANPFKESR
VLNLSVGETTHRLELEPESFNTIVIPA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcaaaccattcagtggttttccacttccaaagctaatgcttggaaatcccaa
gctcatcatttgaccgaaacccaagagagtgccgacctaacccttacgggagaagcatat
cagctcgtcgagggctttggcggctgttttaatgaattgagttatgtagctctgaatcat
ttggacagcgaagaacgagagcaggtgcttcatgctctctttcacccggagggcgagcac
aaattcacaatctgccgacttcctattggagcgagtgattacgcgctggaatggtacagc
cacaatgaaacggatggcgacatggagatgaagcacttttccattgagcgcgatcagcaa
tatctcataccttttattcgggaagcgttacaactcaatccagacttgaagctgttcgcc
tcaccctggagtccaccgacatggatgaaatcacccaaagcttacaattacggcacactg
cgctgggaaaaggatattttgaaagcgtatgcattgtactttgtcaaatttgttcaggca
taccgcaaggcaggcattacgattcaccaggttcatgttcaaaatgaagtcattgccgat
cagaagttcccttcctgtgtatggaccggagaacagctgcgtgaatttattcgcaactat
ttggggcccgcttttgaggaacatgggctggatacagagatttggctgggtaccattaac
gcccctgatccgtgggaggaattaatgaaaaagacgtcgaccggatttgatgagtatgcc
cacaccgtgttgagtgaccccgaggcctataaatatattaaaggggtaggctatcaatgg
gcaggcaaaaatgccattcagcgcactgtagccagctatcctgagcttcgttacatgcaa
accgaaaatgaatgcggaaacggagaaaactcatgggactacgccaaatacgtatataac
ctgtatcagcactatttcaccaatggtgtgaatgcttatatttactggaatatggttttg
gagccgaaaggcaagagcacatggggctgggagcaaaattcgatgatcaccgtggatcca
gcgaatcgaaaacctattctgaacccggaatattacgttatgaagcacttttctcatttt
gtattaccaggggccagacgcattggaattcggggttcatgggctggaaatgcggttgct
tttcaaaatacagacggacaaaaggttctggtcatcgccaacccgtttaaggaatctcgc
gtgctgaatctgtctgtcggagaaacaacacaccgtttggagctggagccggagtccttt
aacaccatcgttattcctgcttaa

DBGET integrated database retrieval system